(data stored in ACNUC7421 zone)

EMBL: CP001622.PE2

CP001622.PE2         Location/Qualifiers
FT   CDS_pept        1743..2825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0002"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   rec:RHECIAT_CH0000398 probable saccharopine dehydrogenase
FT                   protein (NAD(+), L-lysine-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54314"
FT                   /db_xref="GOA:C6AY90"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY90"
FT                   /inference="protein motif:PFAM:PF03435"
FT                   /protein_id="ACS54314.1"
FT                   /translation="MSFEKIAVLGLGKVGRLAATLLHEGGFEVIGVDAQLPLSDVPFKC
FT                   RIGDISDPQVIGELLSNVEAVLSCLPYHLNIELARAAHLAGIHYFDLTEDVPTTNFIIE
FT                   LSKTARGLMAPQCGLAPGFVGIIGASLADGFDRCRSIRMRVGALPQHPTGLLGYAFNWS
FT                   PEGVVNEYLNDCEVIEGGVRKLVSPMEWHETVYVGGVKLEAFTTSGGLGTMCDTMLGKI
FT                   DNLDYKTMRYPGHMELMNFFFHELLMRDKRKLAGEILTNAKPPVEDDVVYVHVAAEGTE
FT                   NGSLRRKEFVRAYYPIEIAGARRTAIAWTTSASVVAVIEMVRDGLLPTTGFLHQEHIPL
FT                   EMFLKTPTGSLFKAGATSHG"
     atgagtttcg aaaagatcgc cgttctcggc ctgggcaagg tcggacggct ggcggcgacg        60
     ctgttgcatg aaggcggctt cgaggtcatc ggcgtcgatg cgcaattgcc gctgagcgac       120
     gtccccttca agtgccgcat cggcgatatc tccgatcctc aagtgatcgg cgaactgctc       180
     tcgaatgtcg aggcggtgct gtcctgcctg ccctatcatt tgaatatcga gctggcgcgc       240
     gccgcccatc ttgccggcat tcattatttc gatctgaccg aagacgttcc gaccaccaat       300
     ttcatcatcg agctgtcgaa gacagcccgc ggcctgatgg cgccgcaatg cggcctggcg       360
     ccgggtttcg tcggcatcat cggtgcaagc ctggccgacg gcttcgatcg ctgccggtcg       420
     atccgcatgc gcgtcggcgc cctgccgcag catccgaccg gactgctcgg ctacgccttc       480
     aactggtcgc ccgagggcgt cgtcaacgaa tatctgaacg actgcgaggt catcgagggc       540
     ggtgtgcgca agcttgtctc gccgatggaa tggcacgaga ccgtctatgt cggcggcgtc       600
     aagctcgaag ccttcacgac gtccggcggc cttggcacca tgtgtgacac catgctcggc       660
     aagatcgaca atctcgatta caagaccatg cgttatcccg gccatatgga gctgatgaat       720
     ttcttcttcc acgagctgtt gatgcgcgac aagcgcaagc tcgccggcga gatcctgacc       780
     aatgccaagc cgccggttga agacgatgtt gtctatgtcc atgtcgccgc cgaaggcacc       840
     gagaatggca gcctgcgccg caaggaattc gtgcgcgcct attacccgat cgagattgcc       900
     ggcgcgcgcc gcacggcgat cgcctggacg acgtcagcct ccgtcgtcgc cgtcatcgag       960
     atggtccgcg acggcctgct gccgacgacc ggcttcctgc accaggagca tattccgctg      1020
     gagatgtttt tgaagacgcc gaccggcagc ctcttcaagg cgggtgcgac cagccacggc      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page