(data stored in ACNUC7421 zone)

EMBL: CP001622.PE20

CP001622.PE20        Location/Qualifiers
FT   CDS_pept        complement(18450..19442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0020"
FT                   /product="Nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bpy:Bphyt_4729 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54332"
FT                   /db_xref="GOA:C6AYA8"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA8"
FT                   /inference="protein motif:PRIAM:3.5.5.1"
FT                   /protein_id="ACS54332.1"
FT                   /translation="MTIVKAAAVQISPSLYSREETVDKVVTKIADLGDKGVQFATFPET
FT                   VVPYYPYFSFVQSAYDLRTGKEHLRLLDQSVTIPSDTTRTIAEACKRARVVVSIGVNER
FT                   DGGTIYNTQLLFDADGTLLQRRRKISPTFHERMIWGYGDGSGLRAVDSAVGRIGQLACW
FT                   EHYNPLARFALMADGEQIHSAMYPGSFGGDLFSEQMAVNIRQHALESGCFVVNATAWLD
FT                   PQQQAQVMEDTGCSIGPISSGCFTAIVAPDGSLIEEPLRSGEGVVIADLDFTLIDKRKQ
FT                   LMDSRGHYSRPELLSLLIDRTPTIHVHERITPSVPTNTAEVTEGGPALV"
     atgacaatcg taaaggccgc cgcggtccag atcagtccct cgctttacag ccgtgaagaa        60
     acggtcgaca aagtcgtcac caagatcgcc gaccttggtg acaagggggt ccagttcgcg       120
     acctttcccg aaacggtcgt cccatattac ccgtatttct ccttcgtcca gtccgcctat       180
     gacttgcgga caggaaaaga gcatctgcga ttgctggatc aatcggtcac catcccatct       240
     gacaccacac gcaccatcgc tgaagcctgt aagcgagcga gggtggtcgt ttccataggg       300
     gtcaatgaac gcgacggggg cacgatctac aatacccagt tgctgtttga tgccgatggt       360
     actttgttgc agcgacgccg caagatttca ccgaccttcc atgaaaggat gatctgggga       420
     tatggagacg ggtctggcct tcgggctgtc gacagcgcgg tgggacgtat cggccaactc       480
     gcatgctggg agcattacaa tccgcttgcg cgcttcgcgc tcatggctga tggcgagcaa       540
     attcactcgg caatgtatcc cggctcgttt gggggggatc tgttttccga acagatggct       600
     gtcaacatcc ggcagcacgc gctggaatcc ggttgtttcg tggtcaatgc aacagcctgg       660
     ctcgacccgc agcaacaggc ccaggtcatg gaagacaccg gctgtagtat cggtccgatt       720
     tccagcggct gctttaccgc gattgtcgca ccggacggca gcttgatcga ggaaccattg       780
     cgctcaggcg aaggcgtcgt gattgctgat ctcgacttca ccctgatcga caaacgcaaa       840
     cagctgatgg attcacgcgg acactatagc cggcccgaac tgctcagtct gttgatcgat       900
     cgtacgccga caattcacgt gcatgagcgc atcacgccgt ccgtgccgac gaatactgcc       960
     gaggtcactg aaggaggtcc tgcgttggtc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page