(data stored in ACNUC7421 zone)

EMBL: CP001622.PE200

CP001622.PE200       Location/Qualifiers
FT   CDS_pept        complement(206135..207463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc02153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54512"
FT                   /db_xref="GOA:C6B093"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C6B093"
FT                   /inference="similar to AA sequence:KEGG:SMc02153"
FT                   /protein_id="ACS54512.1"
FT                   /translation="MALRLDKLSLTNFRCFANCEIEFHSGLTVLVAQNGSGKTAVLDAA
FT                   GAALSVFVNTLYPLEKIWRIERSDVRLIPGQEHKMSPCLPVEYEAQATVQATSVTWRSA
FT                   VRTYGDKVRPSTRNLGPISMAAQPFLSDTAVLPLIAYYGTGRLWNEQRQTEYRRSSVTN
FT                   VDERVAGYADCLTSSSSFKGISAWFEHRFRQTASPLYRESLQTNLAMIEGVKTATDTVL
FT                   QPTGWSNLRWDDELHTLTAKHDGRGELPLSMLSDGVRTMLALVADVARRCASLNPQLSD
FT                   QAALKTPGVLIVDEVDMHLHPSWQQQVLGLLQSAFPALQIIVSTHSPHVLSTVEKSSIR
FT                   VLHVKNGDVVVETPLVQTRGVESADVLATVMDVDPVPALEESTALSAYRKLIEAGEAEG
FT                   QEASALRYRLNAHYGESHPVMLEADRLIRFQRFRLAKSRPESA"
     atggcgctgc gtctcgacaa gctctcgctg acaaattttc ggtgcttcgc taattgcgaa        60
     atcgaattcc attccggtct cacagttctg gtcgcccaga atgggagcgg taagaccgcg       120
     gtgctcgacg ccgccggcgc tgctctttcg gtcttcgtta acacgcttta tccgctcgag       180
     aagatttggc ggatcgagcg gagcgatgtg cgcttgatcc ccggtcagga gcataaaatg       240
     tctccctgcc tcccagtcga atacgaagcg caagcgaccg ttcaggccac ttcagtaact       300
     tggaggagcg ccgtcagaac gtacggtgac aaagtacgcc cgagcacccg gaacctcggc       360
     ccgataagta tggctgcaca accattctta tccgatacgg cggtacttcc gctcatcgcc       420
     tattatggaa cgggccgcct ctggaacgag cagcgccaga ccgaatatcg ccgttcctcc       480
     gttacgaatg ttgatgagcg cgtagccgga tatgccgact gcctcacctc gtcttcgtcc       540
     ttcaagggca tttcggcgtg gtttgagcat cgcttcaggc agacggcgtc gccgttatat       600
     cgggagagcc tgcaaactaa tctcgcgatg atcgaaggtg tgaagaccgc caccgacacc       660
     gttctgcagc caaccggctg gtcgaatctt cgttgggatg acgagcttca tactctgaca       720
     gccaagcacg acgggcgcgg cgaactgccg ttgtccatgc tgagcgatgg tgtccgcacc       780
     atgcttgcgc ttgtcgcaga cgtcgcgcgg cgttgcgcta gtctcaatcc acaactgagc       840
     gatcaggccg cgctcaagac tcctggcgtc ctcatcgtag atgaagtgga tatgcatcta       900
     catccaagct ggcagcagca ggttcttggc ttgctgcaaa gcgcgtttcc tgccctacag       960
     atcatcgtta gcacgcatag cccgcatgtg ctgtcgacgg tcgaaaaatc atcgatccgt      1020
     gtccttcacg tcaagaacgg ggacgtagtg gttgagacgc ctttggttca gacccgcggg      1080
     gtcgagagtg cggatgtcct cgctaccgta atggacgtgg accccgttcc agcgcttgag      1140
     gaatcgaccg ctttaagcgc ctatcgtaag ctcatcgagg cgggcgaagc cgagggccag      1200
     gaagcgtcag ccctgcggta tcgcctgaac gcgcactacg gcgaaagcca tccggtcatg      1260
     ctcgaggcgg atcgcctcat ccgtttccaa cggttccggc tcgccaagag ccggccggag      1320
     agcgcgtga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page