(data stored in ACNUC7421 zone)

EMBL: CP001622.PE201

CP001622.PE201       Location/Qualifiers
FT   CDS_pept        complement(207463..210975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0202"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   sme:SMc02152 putative helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54513"
FT                   /db_xref="GOA:C6B094"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C6B094"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACS54513.1"
FT                   /translation="MKLEEIKSGQSLSGIEPSQVVMVVALIPLSEGSVQLIYRTPDGGI
FT                   KERLLNRGDERTVEVASAERPFSFDGDGAAFQLACEAKRIDLAFLFDPMMAVHSSNVEP
FT                   LPHQITAVYESLLPRQPLRFVLADDPGAGKTIMAGLYIRELIMRADSHRIVIVAPGGLV
FT                   EQWRDELYEKFGLEFYVYSSLLEQTSPSGNAFDDYPRLIVRLDQLSRSEELQDKLCAPG
FT                   WDLAVFDEAHKLSAHYFGSKLEKTGRFRFAEKLGAHARHLLLMTATPHNGKEADFQLFL
FT                   SLLDSDRFYGKFRDGVHKVDASDLMRRMVKEELVKFDNTPLFPERKAYTANYQLSQIEA
FT                   SLYEAVTSYVQTEMGKADQLEGARKGSVGFALAALQRRLASSPEAIFQSLKRRRERLES
FT                   RLRGEKLGIKGRQAVAETYASAPEDDDDLSAEEQESLEENLIDDATAAKTVAELEAEIV
FT                   ILKGLEEQAKAVVASGQDRKWDELSRILQNNPEMRDASGRQRKIIIFSEHRDTLNYLQA
FT                   RIAGVLGNPDAIVTIHGGTHRDERRRLQALFRSDPDVRVLVATDAAGEGVNLQNANLMV
FT                   NYDLPWNPNRLEQRFGRIHRIGQTEVCHLWNLVAKETREGDVYHRLLLKLEVESQALHG
FT                   RVFDVLGEVFEETSLKDLLVEAIRYGDRPDVRARLTLKIDKALDHDHLKSLLNRNALAQ
FT                   ETMSPERLFAVKEEMEKAEARRLQPYFVRAFFSKALDALGGTAHPREAGRYEISHVPSA
FT                   IRERDRRQNGRNRRDHEPVLRRYSRICFERQAIQPLDRAGLERAVLMHPGHPLMLAMSD
FT                   MILEQHTNLLRQGSILVDPSDDGLDPALLFLLTHEIKSGDNTVLSKRLQFVRVGPDGKT
FT                   TFAGWAPHLDLEPLPEAERPLLKDLLDRPWLSSGHEAGALSFAATTLVPEHYGEVAQRR
FT                   IDNVEKTLNAVHERLSKEIAFWQDRWMKLRDDAVAGKDVRLNLQNVERTLGDLQGRLDN
FT                   RKKELQAMRHVVNGTPVVLGAALIVPAGLMIKLRGDEPIDPVTANFAGDAAARSRIERL
FT                   AMTAVRKAEEARGCRVVDVTAAKCGWDLTSYPPAVDGRQPDPKHIEVKGRVKGANTVTI
FT                   TRNEMLYAFNQGDKFVLAVAIVGENDVVDGPYYIPSPFDREPGWGVASINFSLGDLLAK
FT                   AEVR"
     gtgaagctcg aagaaataaa gtctggtcaa agtctatctg ggattgagcc gtcgcaagtg        60
     gtgatggttg tcgcgctcat cccgctcagc gaaggatctg tccagctaat ctatcggacc       120
     cctgatggtg gcataaagga acggcttcta aatagaggcg acgaacgcac tgtcgaggtt       180
     gcctctgcag agcggccgtt ttccttcgac ggcgatggcg cggcgtttca acttgcttgt       240
     gaggccaagc ggatcgacct tgcgtttctc ttcgatccca tgatggctgt ccatagctcg       300
     aatgttgagc cactgccgca ccagattacc gccgtttatg agtcgctctt gcctcggcaa       360
     cctttgcgat tcgtactcgc ggacgatccc ggagcgggca agaccatcat ggcaggcctt       420
     tatatccgtg agcttattat gcgtgcggat tcgcaccgca ttgtgatcgt tgcgcctggt       480
     ggcctcgttg agcagtggcg ggacgagctt tacgaaaaat tcggtttgga gttttatgtt       540
     tattcgtcac ttctggagca gacttcgccg agcggaaatg cgttcgacga ctatccccgc       600
     cttatcgtca ggctagacca gctctcacgc agcgaggaac tccaggacaa actctgcgct       660
     cctggctggg acttggcggt ctttgacgaa gcacacaagc tctccgcgca ctatttcggc       720
     tccaagctgg aaaagaccgg ccgcttccgc ttcgccgaaa agctgggcgc ccatgcccgt       780
     catctgctct tgatgactgc gacaccacac aatggtaagg aagcggactt ccagcttttc       840
     ctttcattgc tcgactccga ccgcttctac ggcaaattcc gcgacggcgt tcacaaggtt       900
     gatgcctcgg acctaatgcg ccgcatggtt aaggaagagc tggtgaagtt cgataacacg       960
     ccgctctttc cggaacgcaa ggcgtacacg gccaattacc agctctcgca gatcgaagcg      1020
     tccctatacg aggccgtgac cagttatgta cagaccgaga tgggcaaagc cgaccagctc      1080
     gaaggcgcga gaaagggttc agtgggcttc gctctcgcag cgctgcagcg gcgcctcgcc      1140
     tctagccccg aagcgatctt ccaatccctg aagcgccgcc gcgagcggct ggagagccgg      1200
     ttgcgcggcg aaaaactcgg aatcaagggg cgtcaggccg ttgccgaaac ttatgccagc      1260
     gcaccagagg atgacgatga ccttagcgct gaggaacagg aatctctcga ggaaaacctg      1320
     atcgacgacg cgaccgcagc caagacagtc gccgaacttg aagctgaaat cgttatcttg      1380
     aaggggctgg aggagcaggc caaagctgtc gtcgcctccg ggcaggaccg caaatgggac      1440
     gagctatcga gaatccttca gaacaatccc gaaatgcgcg acgcctccgg tcgccagcgc      1500
     aagataatca ttttctcgga gcaccgcgat actctgaact accttcaggc gcggattgca      1560
     ggtgtgctcg gcaatccaga tgccatcgtg acaatccacg gtgggacaca ccgcgacgag      1620
     cgccgccgcc ttcaggcgct cttccgctcc gatcccgacg tccgcgtgct ggtagcgacc      1680
     gacgccgcag gcgaaggcgt caaccttcag aacgcgaacc tcatggtcaa ctatgatctg      1740
     ccgtggaacc cgaaccggct ggagcagcgg ttcggccgta ttcaccgcat cgggcaaacc      1800
     gaggtctgcc acctgtggaa tttggtcgcc aaggaaacac gcgagggtga tgtttaccac      1860
     cgcctgctgc tgaagctgga ggtcgagagc caggccttgc acgggcgcgt gttcgacgtt      1920
     ctcggcgagg ttttcgagga aaccagcctg aaggacctgc tggtcgaggc gatccgctac      1980
     ggtgatcgcc cggatgtacg cgcgcgtctc acgttaaaga tcgacaaggc actcgaccac      2040
     gaccacttga aatccctctt gaatcgcaat gctctcgctc aagagaccat gagtcctgaa      2100
     cgtctgttcg ccgtgaagga agaaatggag aaggcggagg cacggcggct tcagccttac      2160
     ttcgtccgag cctttttctc caaagcgctc gacgcgctcg gcggcacagc acacccgcga      2220
     gaggccggcc gctacgagat tagccacgtt ccatcggcca tccgcgagcg ggatcgccgc      2280
     caaaacggcc gaaaccgccg cgaccatgag ccggttttgc gacgctacag ccgaatttgc      2340
     tttgagcgcc aggccatcca gccgctcgac agggcggggc tggagcgtgc cgttctgatg      2400
     caccccggcc atccgctcat gcttgctatg tcggatatga tactagagca gcataccaac      2460
     cttcttcggc agggttcaat ccttgttgac ccatccgatg acggactcga cccagcgctg      2520
     ctgttcctgc tgacgcatga gatcaagtcc ggcgacaata cagtcctatc caagcgcctg      2580
     cagtttgttc gggttggtcc tgacggaaaa acgaccttcg ccggatgggc gcctcacctc      2640
     gaccttgagc ctctcccgga agctgaacgt cccttactca aggatttgct cgacagacct      2700
     tggctgtcct ccggtcacga agcgggtgca ttgtctttcg ccgcgacaac gctggtacca      2760
     gagcactatg gcgaggttgc tcagcggcgt atcgacaacg ttgagaagac gctgaacgcc      2820
     gttcatgagc ggttgagcaa ggaaatcgcg ttctggcagg accgttggat gaaactgagg      2880
     gacgacgccg tggccggaaa agacgtccgc ctcaaccttc agaatgtcga gcgcacgctt      2940
     ggcgaccttc agggtcgttt ggacaatcgg aagaaagagc ttcaggccat gcgccatgtc      3000
     gtgaacggta cgccagtcgt gctgggcgcg gcgctgattg tgccggctgg attaatgatc      3060
     aagctgcgcg gcgacgagcc aattgatccg gtaacggcga acttcgcggg cgacgcggct      3120
     gcgcgctcac gcattgaacg gctcgccatg acagccgttc ggaaggccga ggaagctcgt      3180
     ggttgtcgtg tcgtcgatgt cactgccgca aaatgcggct gggatttgac ttcctacccg      3240
     ccggccgttg atggcagaca acccgatcca aaacacatcg aagtcaaggg gcgggtgaag      3300
     ggcgcgaata ccgtcacgat cacccgaaac gaaatgctct atgccttcaa ccagggcgac      3360
     aagttcgtac tagcggtcgc catcgtcggc gagaacgatg tcgtcgacgg tccatattat      3420
     attcccagtc cgtttgaccg cgaacccggt tggggggtgg cgtctattaa tttcagtttg      3480
     ggcgatttgc ttgcaaaagc agaggttcga tga                                   3513
//

If you have problems or comments...

PBIL Back to PBIL home page