(data stored in ACNUC7421 zone)

EMBL: CP001622.PE202

CP001622.PE202       Location/Qualifiers
FT   CDS_pept        complement(211311..213323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0203"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   rsh:Rsph17029_3200 ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54514"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B095"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ACS54514.1"
FT                   /translation="MSRDDRKRAIGKIVSVAADRFVVEMHSGTDNFTVVGFDDVHYVAR
FT                   LGSFLMVPVQDEYVVVEVVGLRERDSGNPGHGSGDMDKAASAKYLDVVPVGMLPQVRGA
FT                   KFRFGVSIYPSLYADALYALDAELDRVFETEVVTEQPPDPGGQALPTRYNALSIGRSVV
FT                   FEGYDVKVKIDEFFGAHTAVLGNTGSGKSCTISSVLQSLFQKPDEHRARGATFIVFDVN
FT                   GEYWQSLSPLAADEGIGVSRLVLDGSAEPGRFRLPHWFLDQTEWELLLQASERTQMPVL
FT                   RTALGLTGLFRKDSPEALLVKEHFMARCIIECFRGADGDSPVSKFHRVVSLLQRYPTKD
FT                   LNLALLRAYGANFQFGNFANNNLVPFLEKVGEKVREEIKLPSYDRTPFAFDDLEECLDF
FT                   AILYEESHGNRQIRDYCSQMVTRLKSLKERSDFRFLRHELPTEGDAPTTGTFLKTLLGL
FT                   REAGPGGKLIKDAQIVVVDMNDVEDEVVELVSSVLARMTFRLLRQADPRNRFPVHLLLE
FT                   EAHRYISETPSRFAIDAHRIYERIAKEGRKYGLFLLVASQRPSELSKTVLSQCSNFVVH
FT                   RIQNPDDLSQIRQMTPFISDAVLKRLPSLPKQHALVFGTSVNLPTTFRVRNADPLPKSD
FT                   DAKIRDLWFHGADRAAGISFSQSSAPPGLLESEAC"
     atgagccgag atgacaggaa gagagcgatt ggtaaaatcg tttcggtcgc tgccgaccgg        60
     ttcgtagtcg agatgcattc tggaacggac aatttcaccg tagtcggctt cgacgacgtc       120
     cattacgtcg ctcggctcgg gtccttccta atggttccag tccaagatga atacgtggtc       180
     gtcgaggttg tcggcctccg cgaacgggat tctggaaatc cgggtcacgg cagcggcgac       240
     atggacaagg cagcttcagc gaaataccta gacgtggtgc cagtcggcat gcttccgcag       300
     gttcgcggcg ctaaatttcg cttcggcgtc tcaatctatc catctctcta tgcagacgcg       360
     ctctacgcgc tcgacgcaga actcgacagg gttttcgaga cggaagtcgt taccgagcag       420
     ccgccggatc ccggcggcca ggcgcttccc acccgataca acgctctctc gatcgggagg       480
     tcggtcgtgt tcgaaggtta cgacgtaaag gtcaagatcg acgaattctt tggcgcacac       540
     acagcggttc tcggaaacac aggcagcggg aagtcctgca cgatctcttc ggtgctgcag       600
     tcgctatttc agaaaccgga cgaacaccgc gcacgcggcg cgacattcat cgtctttgac       660
     gtgaatggcg agtactggca atcgctatcc ccgttggcag cggatgaagg tattggggtt       720
     tcacgtctgg tccttgatgg atccgcagaa cccggccgct tcaggctccc tcactggttc       780
     ctcgaccaga ccgaatggga gctgcttctc caagcgagcg agcgcacgca gatgcccgtg       840
     ctaagaacag ctctgggtct gaccggatta ttcagaaagg actccccgga agccttgctc       900
     gtcaaagagc atttcatggc tagatgcatc atcgagtgct ttcggggagc ggacggcgac       960
     tctcccgtgt cgaagttcca tcgcgtcgtc tctctcctac agaggtaccc gaccaaggat      1020
     cttaacctgg cactgctgcg cgcctacggc gccaatttcc aattcgggaa ctttgccaac      1080
     aataatctcg tgccgttcct tgaaaaggtc ggagagaagg ttcgggaaga gatcaagctt      1140
     ccctcatacg accgcacccc ttttgctttc gatgatctcg aggagtgtct ggactttgcg      1200
     atcctctatg aagagtcgca tggcaatcgg caaatacgcg actactgctc gcaaatggtg      1260
     acccggctga aatccttgaa ggagcggtcc gacttccgat ttctgcgtca cgagctacca      1320
     accgaaggcg acgcaccgac aactggaacg tttcttaaaa cattgctcgg cctccgtgaa      1380
     gctggccccg gcggcaagct catcaaagac gcccagatcg tcgtcgtcga catgaacgac      1440
     gtcgaggacg aggtcgtcga actcgtctca tccgttctcg cgagaatgac tttcaggctg      1500
     ctcaggcagg ccgaccccag gaaccgcttc cccgtacatc ttctccttga ggaagcccac      1560
     cgatacattt ctgaaactcc gtcgcgattt gcgatcgacg ctcaccgtat atacgagagg      1620
     attgcgaaag agggcaggaa gtacggcctc tttcttctcg tcgcctctca acgaccgagc      1680
     gagctgtcga agacggtgct ttcccagtgt tctaacttcg tagtccatcg tatccagaat      1740
     cctgatgacc tgtcccagat ccggcaaatg acaccgttca tctctgacgc tgtcctgaag      1800
     cgcctaccgt cgctgccaaa gcaacacgct cttgtatttg gaacatccgt caatcttccc      1860
     actacgtttc gcgttcgcaa cgctgatccc ttgccaaaaa gcgacgacgc caagatccga      1920
     gacctatggt ttcatggagc tgatcgagct gccggtatca gcttttctca atcatcagcg      1980
     ccgccaggcc tgctcgagag tgaagcatgt tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page