(data stored in ACNUC7421 zone)

EMBL: CP001622.PE203

CP001622.PE203       Location/Qualifiers
FT   CDS_pept        complement(213320..214357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_3199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54515"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C6B096"
FT                   /inference="similar to AA sequence:KEGG:Rsph17029_3199"
FT                   /protein_id="ACS54515.1"
FT                   /translation="MVRELDDPAFPTKAERTAMLELFGIQIEADEYARNLERLMELLFS
FT                   MRFVLKRSSHETTADGIKLVEGIITKVQAFLWERCTNGVFATGDGTVRGFYETFYRKLV
FT                   LRDRSLPRPWVFTTNYDVFNETAMDRLGLPYANGFSGVVERRFNPATFRYALAEQLDVS
FT                   SRKWSAVDGFVYLCKLHGSITWTEDDHGLFPIREMAPGKQPGKVMIYPTPAKQNSSLGS
FT                   PYSDLFREFQSRVVREQSVLFTMGYAFGDEHINNIIYQALTIPTFRLVIFVDPELGGEI
FT                   AKLRALEDPRIWIIGGDGREKGQKAHYFDTIVEEFMPQRPTERIDEAVRKVLETMGAAS
FT                   RGEAE"
     atggtgcgtg agctggacga tcccgctttt cccaccaagg ctgaacgcac ggccatgctt        60
     gaacttttcg gcatccagat cgaggctgac gaatacgcgc gcaatctcga gcgactcatg       120
     gaactactct tcagcatgag gttcgtcctg aagcggagtt cgcatgagac taccgctgac       180
     ggcatcaagc tggtggaagg catcatcaca aaagttcagg cgttcttgtg ggagcggtgc       240
     acgaacggcg tttttgcgac cggcgacgga acggtccgcg gcttctatga aacattctat       300
     cggaagcttg ttcttcgcga tcggtcactt cccaggccat gggtgttcac gacaaactac       360
     gacgtcttca acgagacggc gatggacagg cttggtctcc cttatgcgaa cggcttctcc       420
     ggagtcgtcg aaagaagatt caacccggcc accttccgct acgcattggc cgagcagctc       480
     gatgtgtcca gtcgcaagtg gtcggcggtc gacgggttcg tatacctgtg caagctacat       540
     ggctcgatca cctggaccga agacgaccat ggactatttc cgataaggga gatggctccg       600
     ggcaagcagc ctggcaaggt catgatctac cccacgccag caaaacagaa ttcgagtctc       660
     ggatccccct attcggacct gttccgtgaa ttccagtcgc gggtcgtccg ggagcagagc       720
     gtgctgttca cgatgggata cgccttcggc gacgagcaca tcaacaacat catctaccaa       780
     gccctcacca ttccgacgtt cagactggtc atcttcgtcg atccggagct cggcggcgag       840
     atcgcgaagc ttcgagcact ggaagatcct cgtatttgga tcatcggcgg tgatggccgt       900
     gaaaagggac agaaagcgca ttacttcgac acgatcgtcg aagaattcat gccccagcgt       960
     ccaacggaac gcatcgacga agcggtcaga aaagtacttg agactatggg cgccgccagc      1020
     agaggcgagg ccgaatga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page