(data stored in ACNUC7421 zone)

EMBL: CP001622.PE204

CP001622.PE204       Location/Qualifiers
FT   CDS_pept        complement(215709..216218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0205"
FT                   /product="protein of unknown function DUF995"
FT                   /note="PFAM: protein of unknown function DUF995; KEGG:
FT                   smd:Smed_3668 protein of unknown function DUF995"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54516"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:C6B097"
FT                   /inference="protein motif:PFAM:PF06191"
FT                   /protein_id="ACS54516.1"
FT                   /translation="MSMLQKMFLAVVLTGGIATAASAAGTNEPAGIETAKPMSSAEIYR
FT                   LYNQNSWMWKAGAGYFSAKARRFTAWSRENGSPSFGTGRWFITETGKLCFNADWHAKTG
FT                   TATAITCFSHRKKGGLIYQKREPDGEWYVFKSAPAQATDEFAKLRRGDYVRSQLGGIEM
FT                   SVSKTR"
     atgtccatgc ttcaaaaaat gttcctggcc gtggtcctga ccggcggtat cgccacggcc        60
     gcgtccgctg ccggaaccaa tgagcctgcg gggatcgaga ccgcaaaacc gatgagcagc       120
     gcggaaatct atcggctcta caaccagaat tcctggatgt ggaaagccgg cgccggctac       180
     ttctccgcaa aggcgcgtcg ctttaccgcc tggtcgcggg aaaatggctc gccgtccttc       240
     ggcacgggcc gctggttcat cacggaaacg ggtaaactct gcttcaacgc cgactggcac       300
     gccaagaccg gaacggcgac ggcaatcacc tgcttcagcc accgcaagaa gggcggcctg       360
     atctatcaga aacgcgaacc ggacggtgaa tggtacgttt tcaagagcgc accggcacaa       420
     gccaccgacg aattcgcaaa gcttcgccgc ggcgactacg tgaggtctca attgggggga       480
     attgagatga gcgtcagtaa gaccagataa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page