(data stored in ACNUC7421 zone)

EMBL: CP001622.PE205

CP001622.PE205       Location/Qualifiers
FT   CDS_pept        complement(216237..217202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0206"
FT                   /product="putative cellulase H precursor protein"
FT                   /note="KEGG: sme:SM_b20462 putative cellulase H precursor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54517"
FT                   /db_xref="GOA:C6B098"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:C6B098"
FT                   /inference="similar to AA sequence:KEGG:SM_b20462"
FT                   /protein_id="ACS54517.1"
FT                   /translation="MHSPSKIALLSLTGLLLSGVAVLPTALGSSAEGQPLAMTTSSIAP
FT                   PTKMPVVTKESITFGAYDPHGDLGASPDSKIEHLFLPWEDVDLRTLALADDYAQARGRT
FT                   LLISVEPWTWSTGSRQTSQELLHSILNGSRDANMAAVCSTAAKLKSPVIIRWGQEMDET
FT                   DSQFSWSHWQGDDYAKAYRRMVEVCKVHLKTAKYMWSPKGNEGLQAFYPGNDVVDLIGL
FT                   SVFGLEQYDRDKTGRDQTFAEHLAPGYARVAGYGKPIMVAELGYEGGDSFVRNWAESVT
FT                   KRYPQFPALSAVVYFNDREVYPWPDGYGRPDWRIVRESIN"
     atgcatagcc catccaaaat agccctgttg tcgttaaccg gcctgttgct gtcgggagtc        60
     gcggtcctgc cgaccgctct gggcagttct gccgaagggc agccgcttgc aatgacgaca       120
     tcgtccattg cgccgccgac caaaatgccg gtcgtcacga aggagtcgat cacgttcggc       180
     gcctatgatc cgcacggaga tttaggcgcc tcgcccgatt cgaagatcga acacctcttc       240
     ctgccctggg aagatgtcga tctgcgcacg ctcgccctcg ccgacgatta tgcgcaagcg       300
     cgtggccgca ccctgctgat ctcggtcgag ccctggacct ggtcgaccgg ttcgcgccaa       360
     acctcgcagg aactgctgca cagcatcctc aacggttcgc gcgatgcgaa catggccgcc       420
     gtctgctcga ctgctgccaa gctgaaaagt ccggtcatca ttcgctgggg acaggaaatg       480
     gacgaaaccg acagccagtt ctcctggtcg cattggcagg gcgacgatta tgccaaggcc       540
     tatcgccgga tggtggaggt ctgcaaggtc cacctgaaga cggccaaata catgtggtca       600
     ccgaagggca atgaggggct tcaagccttt tatcccggca acgatgtcgt cgatctcatc       660
     gggctctcgg tctttggcct ggagcaatac gacagggaca agactggccg cgaccagacg       720
     tttgccgagc accttgcgcc cggatacgcc cgtgtcgccg gttacggcaa gcccatcatg       780
     gttgccgaac tcggatacga aggcggcgat tccttcgtgc gaaactgggc tgagagcgta       840
     acgaaacgct atccccagtt cccggcgctg agcgccgttg tctacttcaa cgaccgtgaa       900
     gtctatccgt ggccggacgg ctatggccgc cccgactggc ggatcgtccg cgaaagcatc       960
     aattga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page