(data stored in ACNUC7421 zone)

EMBL: CP001622.PE206

CP001622.PE206       Location/Qualifiers
FT   CDS_pept        complement(217195..219102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0207"
FT                   /product="putative cellulose synthase protein"
FT                   /note="KEGG: sme:SM_b20460 putative cellulose synthase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54518"
FT                   /db_xref="GOA:C6B099"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B099"
FT                   /inference="similar to AA sequence:KEGG:SM_b20460"
FT                   /protein_id="ACS54518.1"
FT                   /translation="MTELAIIQATHAPEPSHEPLLVPVLTGHRRTEYLFSAAVWACAFA
FT                   YFWIWWLEPRHHVDAFGTITVSLVLAWVTALPAYFIVVFYRAARPNGPLRLPAGSRVAM
FT                   VVTKAPAEPFSVVSETLLAMLAQEVEHDTWLADEDPSPETLDWCSRHGVLVSTRKGRSD
FT                   YHRTSWPRRTRCKEGNLAFFYDHYGYSRYDFVAQLDADHVPAPDYLFHMLRPFGDPKVG
FT                   YVSAPSICDKNASESWSARGRLYAEASMHGSLQAGYNGGLAPMCIGSHYAVRTVALKQI
FT                   GGLGPELAEDHSTTLMMNAGGWRGVHALDAIAHGDGPRTFSDLVTQEFQWSRSLVMVLL
FT                   RYSPSLLGRLPARLKFQFLFSQLWYPLFAFFMLLMFALPIIALVRGQNFVTVTYPDFLA
FT                   HFAPLSIALVVMAYRWRASSSFRPYDAKILSWECMLFLFARWPWALAGTLAAVHDFVTG
FT                   SFVDFRVTPKGRSEVDLLPVRVLAPYAVLALMAVLPALAIADAGASKGGYFFTILNAAI
FT                   YCALLLVIVGRHSKENTVAAAPRFYRPAMATVLLALVALPGAATIMRGKDATEALAWGS
FT                   GRLQLFEERYAASGAGRGGTALRTIFFKPRWISDPEEIQLRTDAAHPDVRPSVEEVHNA
FT                   "
     gtgaccgaac ttgcgattat ccaagcgacg cacgctccgg aaccctccca cgagccgctt        60
     cttgtcccgg ttctgaccgg acatcggcgg accgaatatc tgttctcggc ggccgtatgg       120
     gcctgcgcct tcgcctattt ctggatctgg tggctggagc cgcgccatca cgtcgatgct       180
     ttcggcacaa ttacggtgag cctcgttctt gcctgggtta ccgcgctgcc ggcctatttc       240
     atcgtcgtct tctatcgggc ggcaagaccg aacggtccct tgcgcctgcc ggcgggcagt       300
     cgagtggcca tggtcgtgac caaggcgccg gccgaaccct tctcggtcgt cagtgaaacc       360
     ctgctggcaa tgcttgccca ggaggtggaa cacgacacct ggcttgccga cgaagaccct       420
     tcccccgaga ctctcgactg gtgctcccgt cacggggtcc tcgtctcgac ccgcaagggg       480
     cgatccgatt atcatcggac gtcgtggccc cgacgcacgc ggtgcaagga aggcaacctc       540
     gccttcttct acgaccacta cggctacagc cgctacgatt tcgtggcgca actcgatgcg       600
     gatcatgttc ccgcgcccga ctatctcttc cacatgctgc gtccgttcgg cgatccaaag       660
     gtcggctatg tctcggcccc cagcatttgc gacaagaacg cttccgaaag ctggtcggca       720
     cgtggaaggc tctatgccga ggccagcatg catggttcgc tccaagccgg ttacaatggc       780
     ggcctggcgc cgatgtgcat agggtcgcat tacgcggtac gtaccgtcgc cctcaaacag       840
     atcggcggcc tcggtccgga gttggctgaa gaccattcga cgacattgat gatgaatgcc       900
     ggcggctggc gaggtgtgca tgcgctggat gccatcgccc atggtgacgg ccccagaacc       960
     ttcagcgatc tcgtgacgca ggaattccag tggtcgcgca gcctggtcat ggtgctgttg      1020
     cggtactcgc cgagcctcct cggccggctg ccggcccggc tcaagttcca gttcctcttt      1080
     tcgcaactct ggtatccgct ttttgcgttc tttatgttgc tcatgtttgc tttgccgatc      1140
     atcgcgctcg tgcgcggcca gaatttcgtg accgtgacct atcccgattt cctggcgcat      1200
     ttcgcaccgc tttctatcgc tctcgtggtg atggcttatc gctggcgcgc cagcagctcg      1260
     ttccgcccct acgacgccaa gatcctgagc tgggaatgca tgctctttct cttcgcccgc      1320
     tggccctggg cgctcgccgg cacgctggct gcggtgcacg attttgtgac aggctccttc      1380
     gtcgatttcc gcgtcacgcc gaaaggccgg tccgaagtcg atctgctgcc ggtgcgtgtc      1440
     ctggcgccct acgctgtgct ggcgctcatg gcggtattgc ctgccctggc aatcgccgat      1500
     gccggcgcct ccaagggcgg ttacttcttt accatcctga acgccgcaat ctactgcgcg      1560
     ctgctgttgg tcatcgtcgg gcgtcattcg aaggagaata ctgttgcggc ggccccgcgt      1620
     ttctaccgtc cggcgatggc gaccgtgctt ctggcgctcg tcgcgttgcc gggggctgca      1680
     accatcatgc gcggaaagga tgcgaccgag gcactcgcct ggggcagcgg ccgccttcag      1740
     ctgttcgaag agcgctacgc cgcctccggt gcaggccggg gcgggaccgc cctgcgcacg      1800
     atcttcttca aaccacgatg gatttccgat ccggaggaaa tccaactgag aacggatgcc      1860
     gctcacccgg atgtgcggcc gagcgtggag gaagtacaca atgcatag                   1908
//

If you have problems or comments...

PBIL Back to PBIL home page