(data stored in ACNUC7421 zone)

EMBL: CP001622.PE207

CP001622.PE207       Location/Qualifiers
FT   CDS_pept        complement(219099..220085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0208"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: sme:SM_b20459 putative UDP-glucose
FT                   4-epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54519"
FT                   /db_xref="GOA:C6B0A0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A0"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACS54519.1"
FT                   /translation="MDAPRVLVTGGAGYIGSHTAKLLRSEGIEPVVYDNLTTGNRSSVR
FT                   WGPFVEGDVLDTSCLIEVIEKYAPDAVIHFAASAYVGESVENPAKYYNNNVCGALSLID
FT                   ACRQTGLQNVIFSSSCAVYGVPSVLPIDETLPKAPINPYGKTKLIFEHMLADYAAAYGL
FT                   RYVALRYFNACGADPDGELGEWHVPETHLIPRALLAAAGRIPHLEIFGDDYDTPDGTCI
FT                   RDYIHVADLARAHVQAFTHLAKGGANLAVNLGTGRGYSIREVLRVIQETTGCEVPVVIH
FT                   PRRPGDPPSLYADASLARETLCFQPRYSDLETIVRTAAPFFGLEVRA"
     atggatgcgc cccgggtcct ggtcacgggc ggtgccggct atatcggcag ccacaccgcc        60
     aagctcctcc gctcggaggg gattgagcct gtcgtctacg acaatctcac gaccggaaac       120
     cgttcgtccg tgcgctgggg gcctttcgtc gaaggtgacg tcctcgacac gtcatgcctg       180
     atcgaggtca tcgagaaata tgctcccgat gccgtcatcc actttgccgc ctcggcctac       240
     gtcggcgagt ccgtggaaaa cccggcgaaa tattacaaca acaatgtctg cggtgcattg       300
     tcgcttatcg atgcctgccg gcagacgggg cttcaaaacg tcatcttctc atcgagttgt       360
     gccgtctacg gcgtcccgtc cgtgctgccg atcgatgaga cgttgccgaa ggctccgatc       420
     aatccctacg gcaagaccaa gctgatcttc gagcatatgc tcgccgatta tgcggcggcc       480
     tacggcctgc ggtatgttgc cctgcgttat ttcaatgcct gtggagccga tccggacggc       540
     gagcttggcg aatggcacgt tccggaaacc catctcattc cgcgggcgct gctggccgcg       600
     gccggccgga ttccgcacct ggagatattc ggcgatgatt acgatacccc tgacgggacc       660
     tgcataaggg actatattca cgtcgcagat ctcgcgcgcg cccatgttca ggccttcacc       720
     catctcgcca aaggcggagc aaacctcgct gtcaacctcg gcaccgggcg gggttattcc       780
     atcagggaag tcctgcgcgt gatccaggaa acgaccggct gcgaagtccc ggtcgtcatc       840
     catccacgcc gtccgggcga tccgcccagc ctctacgccg acgccagcct ggcccgcgag       900
     acgctctgct tccagcctcg atattccgac ctcgaaacca tcgtgcggac ggcggctccg       960
     ttcttcggac tggaggtgcg cgcgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page