(data stored in ACNUC7421 zone)

EMBL: CP001622.PE208

CP001622.PE208       Location/Qualifiers
FT   CDS_pept        complement(220085..221131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0209"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: sme:SM_b20458 putative dTDP-glucose
FT                   4,6-dehydratase protein; SNP /replace=T"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54520"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54520.1"
FT                   /translation="MNYLGKIRARSVQVSARDANCPSGIHRAPKRVLVTGGAGFLGSHL
FT                   CETLLAAGHQVICLDNFSTGMRRNIVHLKRVDRFNVVAHDIVHPLDLEVDEIYNLACPA
FT                   SPPHYQADPIHTTKTCVLGSLNLLELAARTGARILQASTSEVYGDPNVHPQVESYWGNV
FT                   NSFGPRSCYDEGKRCAETLFFDFHNTHGVEIKIIRIFNTYGPRMRPDDGRVVSNFIVQA
FT                   LTGQDITIYGDGSQTRSFCFVDDLIGGMVRMMASPSSLTGPVNLGNPGEFTIRELAEQV
FT                   IGLTGSRSQIIHRALPVDDPRQRRPDISLAMQELDWRPKIDLSSGLRQTIDYFDGVLTR
FT                   PARELEAV"
     gtgaactatc ttggtaagat tcgtgcgcgc tctgtacaag tttctgctcg tgatgcaaat        60
     tgtccttccg gaatacatcg cgctcccaag agagttcttg tcaccggcgg tgcaggtttc       120
     ctcggatcgc atctctgcga gacgcttttg gccgccggac accaggtgat ctgcctcgac       180
     aacttttcca ccggcatgcg gcgcaatatc gtccatctga agcgagtcga tcgcttcaat       240
     gtcgtcgccc acgatatcgt ccacccgctc gatctggaag tcgacgagat ctataacctc       300
     gcctgcccgg catcgccccc gcattatcag gccgatccga tccatacgac aaagacctgc       360
     gtgctgggct ccctcaacct tctggagctg gccgcgcgca ccggcgcacg tatccttcag       420
     gcatccacct ccgaagtcta cggcgacccg aacgtccacc cgcaggtcga aagctactgg       480
     ggcaacgtca attcgttcgg gccgcgctcc tgctatgacg agggcaagcg ctgcgccgag       540
     acgctgttct tcgacttcca caacacgcac ggcgtcgaga tcaagatcat ccgcatcttc       600
     aacacctacg gcccgcggat gcgtccggac gacggccgcg tcgtctcgaa tttcatcgtc       660
     caggccctga cggggcaaga catcacgata tatggcgacg gttcgcagac ccgctcgttc       720
     tgtttcgtcg atgatctcat cggcggcatg gtccgcatga tggcctcacc gtcgtcgctg       780
     acggggcctg tcaatctcgg caatccgggc gaattcacga tccgggaact ggccgagcag       840
     gtgatcggat tgaccggttc ccggtcgcaa atcatccatc gcgctctgcc ggttgacgat       900
     ccccgtcagc gtcgccccga tatttcgctt gccatgcagg aactcgactg gcggccgaag       960
     atcgacttgt cgagcggcct gcgtcagacg atcgactatt tcgatggcgt tctcacccgt      1020
     ccggcacgcg agctggaggc ggtctga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page