(data stored in ACNUC7421 zone)

EMBL: CP001622.PE209

CP001622.PE209       Location/Qualifiers
FT   CDS_pept        221486..222634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0210"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ret:RHE_PE00361 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54521"
FT                   /db_xref="GOA:C6B0A2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS54521.1"
FT                   /translation="MATGSESDDDPAAEQERPAHMERRRWPREPAMRKERPPHASPALV
FT                   PLRFSTQDLPPAEQFQAWRAHMAPLVDVHLPEGKSPEDGFLAEQIGWHLGDILIVQQRA
FT                   HAHRYVRDQAMLRSSPIDHWNVGLQRSGQAWTEVNRRVTETGAGEIFFMSLGSPYRGRT
FT                   TDTEALLVFLPYEMLARDASLLQSAGNTVLSGSHAELLTGYLTGLETNLGNLTIEEVPR
FT                   IIQTIGDMVVAGAASSTRTDTGQNQANMGLMERAHRYIHVNLHSENLTPDVMCRALGIS
FT                   RTRLYQLFEASGGVLNYIRKRRLLQAYADLSNSADHRPISEIAEAAGFEVAANFTRAFI
FT                   HEFGLSPREIRRTMATQQRPAPAIRSTRRYEKTIGDWLALTG"
     atggctacag ggtctgaatc cgacgatgat cctgccgcgg aacaggaacg gccggcgcat        60
     atggagcggc ggcgctggcc gcgtgaaccg gccatgcgca aggaacgccc gccccatgcc       120
     tcccctgcac tcgtgccgct gcgattctcg acgcaggacc taccaccggc agaacaattc       180
     caggcctggc gggcacatat ggcgccgctc gtggatgttc atctgccgga gggaaaatca       240
     ccggaagacg ggttcctcgc ggagcagatc ggctggcatc tcggcgatat cctgatcgtc       300
     cagcagcgcg cgcatgccca cagatatgtc cgcgatcagg ccatgcttcg atcgagccct       360
     atcgaccatt ggaacgtcgg cctgcagcgc agcggccagg cctggaccga ggtcaaccgt       420
     cgtgtcaccg agaccggtgc cggcgagata tttttcatgt cgctcggcag cccctatcgc       480
     ggacggacga ccgataccga agctttgctc gtgttcctgc cgtatgagat gctggctcgc       540
     gatgcgagcc ttctccagag cgccggcaac acggttcttt cgggcagcca cgccgagttg       600
     ctcacgggct atctcacggg cctcgaaacg aacctcggga atctgacgat agaggaagtg       660
     ccccggatca ttcaaaccat cggcgatatg gtcgttgcgg gcgccgcatc gtccacaagg       720
     actgataccg gtcaaaacca ggccaacatg ggactgatgg agcgggcgca ccgctacatt       780
     cacgtcaatc tccattcgga aaacttgaca ccggacgtga tgtgccgcgc gttggggatt       840
     tcgcgaacgc ggctttatca actgtttgag gcgagcggag gcgtgctcaa ttatattcgc       900
     aagcggcgat tgctgcaggc ctatgcggat ctcagcaatt cggccgacca caggccgatt       960
     tcagaaatcg cagaagccgc cggtttcgag gtcgccgcca attttacgcg cgccttcatc      1020
     cacgaattcg ggctgagccc gcgtgaaatc cgaaggacga tggcaaccca acagcggccg      1080
     gctccggcca tccgctccac gcggcgttac gaaaaaacga tcggtgattg gctggccctg      1140
     acgggttga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page