(data stored in ACNUC7421 zone)

EMBL: CP001622.PE21

CP001622.PE21        Location/Qualifiers
FT   CDS_pept        complement(19503..20096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54333"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54333.1"
FT                   /translation="MQRRTLLTLGTGLAVSVLTGFRPAATTTETHHRPAGLWFADMEPD
FT                   GLTRTYRRYRLLLVGQRDDAVASDLSESAVEVLERFLPASRARLIRAADTRRVGVLIGT
FT                   RQQDIAIMTRESAEALFAAGPPFADIRNLPLRLIVSFDSHVLVSRTDFPDSHAYAVAQT
FT                   LTEHKNLLPRPAVAPDGLIPVHRGAHAYFTGETI"
     atgcaacgcc gcaccctatt gaccttaggc acaggcttag ccgtttcagt gcttacgggg        60
     ttccgcccgg cggctacgac caccgagaca caccacaggc ccgccggact ttggttcgcc       120
     gatatggaac ccgacggctt gacgcggacc taccgccggt accgccttct gctcgtcggt       180
     cagagagacg atgcagtcgc gagtgacctg tcggaatcgg cagtagaggt gctggaacgt       240
     tttctgcctg cttcgcgcgc aagactgatc cgcgccgctg acacacggcg cgtcggggtc       300
     ctcatcggca cacgccagca ggatatcgcc atcatgacga gggagagcgc cgaggcgctc       360
     ttcgccgccg gaccgccctt cgccgatatt cgcaatctgc cattaaggct catcgtgtcg       420
     ttcgacagcc acgtgctggt gagccgaacg gattttccgg acagtcatgc ctatgccgtc       480
     gcgcaaacac tgaccgagca caaaaaccta ctgccgagac ctgccgtcgc acccgatggg       540
     ctgatccccg tgcaccgagg agctcacgct tattttacgg gcgaaaccat ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page