(data stored in ACNUC7421 zone)

EMBL: CP001622.PE210

CP001622.PE210       Location/Qualifiers
FT   CDS_pept        complement(222795..223073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54522"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A3"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00530"
FT                   /protein_id="ACS54522.1"
FT                   /translation="MKPAIIGLVGTLVLAGCNTVSYSGPGLEPIPGSITYSGQPRSKLT
FT                   KSPPGSAFPHDFIDQYGREVEETYIIQPDRSLIIAHRQYKPIRFFGD"
     atgaaacctg caatcatcgg cctcgtcggc acgctcgttc tggcgggatg caacaccgtc        60
     agctacagcg gaccgggcct cgaacccatc cccggcagca tcacctatag tggccagccg       120
     cgcagcaagc tcaccaaatc accccccggc tccgccttcc cgcatgactt catcgaccag       180
     tacggccggg aggtggaaga aacctacatc atccagcccg accggagcct gatcatcgcg       240
     catcggcaat acaagccgat ccgctttttc ggggattag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page