(data stored in ACNUC7421 zone)

EMBL: CP001622.PE211

CP001622.PE211       Location/Qualifiers
FT   CDS_pept        223497..223877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0212"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00531 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54523"
FT                   /db_xref="GOA:C6B0A4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54523.1"
FT                   /translation="MRLNHLDFHVPDIAATADFFIRHFGLRLKDMRGQNGLAILEDDTG
FT                   LEIVLSHAIAKFGTADQVEMGRQTYHIGFILPERADVDAVHAGLAAAGAALSGRPAAMR
FT                   GGWLFYCTAPGNILVEIGWRPG"
     atgcgcttga accatctcga tttccacgtt cccgatatcg ctgccacggc ggatttcttc        60
     atccgccatt tcggtctgag gcttaaggat atgcgcggcc agaacggcct ggcgatcctc       120
     gaagacgata ccggcctcga aatcgtcctc agccacgcaa tcgcaaaatt cggcaccgcc       180
     gatcaggtgg agatgggacg ccagacctat cacatcggct tcattctgcc cgagagggcg       240
     gatgtcgatg cggtccatgc cgggcttgct gctgccggtg ctgcgctgtc cggtcggccg       300
     gccgccatgc gcggcggctg gctgttttat tgcacggctc ccggaaacat tctcgtcgag       360
     atcggctggc ggccgggtta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page