(data stored in ACNUC7421 zone)

EMBL: CP001622.PE212

CP001622.PE212       Location/Qualifiers
FT   CDS_pept        complement(224243..224782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecl:EcolC_3640 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54524"
FT                   /db_xref="GOA:C6B0A5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54524.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPDLFAALAAQQEQEGEVQVRVHEGMTG
FT                   TPPPPPLVLRLIVRRKDPQQAQAEQERLLKDARKRGKKPDPRSLEAAKYILLLTSLPTA
FT                   TFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARAWLYARLIVAIIAEQIA
FT                   GQVPDSPPSGCGNPTG"
     atgaagattc gtcctgaggt tttggatcat tggccggaag tgcgcgagcg gcttccggat        60
     ctgtttgccg cactcgccgc tcagcaagag caggaaggcg aggtgcaggt tcgtgtccac       120
     gaaggcatga cggggacgcc gccaccaccg ccgctggtcc tgcgcctcat tgtccggcgc       180
     aaggatccgc aacaggccca agccgagcaa gagcgcctgc tcaaggatgc ccgcaagcgc       240
     ggcaaaaaac ccgatccgcg cagtctcgag gcggcgaagt acattctgct gctgacctcg       300
     ctgccgaccg ccaccttccc gccggccgat atcctcaccc tctatcgctt ccgctggcaa       360
     atcgagctgg cgttcaaacg gttcaagagc ctggccggcc tcgacagctt gccggccaag       420
     aagccggaac tggcccgggc atggctctac gccagactga tcgtcgccat cattgccgaa       480
     cagattgccg ggcaagtccc ggactctccc ccctctggat gtggcaaccc cactggctag       540
//

If you have problems or comments...

PBIL Back to PBIL home page