(data stored in ACNUC7421 zone)

EMBL: CP001622.PE213

CP001622.PE213       Location/Qualifiers
FT   CDS_pept        complement(224903..226894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0214"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: ret:RHE_CH00532 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54525"
FT                   /db_xref="GOA:C6B0A6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54525.1"
FT                   /translation="MLKHLKIRTKIISVVALMGLITMAGLIYVISEFRRADAAYSAFID
FT                   HEAQASMLSARASASAVASVLQVTLIADMKPDTPAFQTALATPSKLPQARDRMKQALAL
FT                   VPSRKPAIDEIQAGIDEIETLANKIIEQSKAKDSAGALSNVALINAKLDALTPKMIANN
FT                   DAMMAMLNDGGDALSASVNGRIVFCFVLIGIAVLAAVGFSVVVAQKGIAGPMTQLRLRM
FT                   TRLAEGDTTSDVSGLDRGDEVGQMAKAVSVFRDNAIERARIEARAETDRDVSDSERRDR
FT                   EAQKAREASELDRAVTALGDGLRRLAAGDLASHIAEPFVAHLDALREDFNNSVEKLNET
FT                   LHTVGANARAIGAGANEIRSSADQLSQRTEQQSASVEETAAALEEITTTVRDAAKRAEE
FT                   ASQLVARARLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGV
FT                   EAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALISTSGSHVQTGVSLVGETGKALD
FT                   AIVQEVQEINQHVHAIAEASREQSIGLQEINTAVNTMDQGTQQNAAMVEESTAASHNLA
FT                   TEASALNNLLGQFRLTGTGGFTTSTPIAAAAPRAAARPAARAAPVRVAREGTARPAASP
FT                   ARALGQKIANAFGAGSTSPSQDPDWTEF"
     atgctgaaac atctgaaaat ccgcacaaaa atcatatcgg tcgtggcgct catggggctg        60
     atcacgatgg ccgggctgat ctatgtcatc tccgaattcc gccgtgcgga tgcggcctac       120
     agcgccttca tcgatcatga agcgcaggcc tcgatgctga gcgcgcgcgc cagcgcatcg       180
     gcggtggcct cggtgctgca ggtcaccctg attgccgaca tgaagcccga tacgccggca       240
     ttccagacgg cgctcgccac accgagcaag ctgccgcagg cgcgtgaccg catgaagcag       300
     gcgctggcgc tggtgcccag ccgcaagccg gcgatcgatg agattcaggc cggcatcgat       360
     gagatcgaaa ccctggcaaa caagatcatc gaacagagca aggccaagga cagcgccggc       420
     gcgctttcga atgttgccct gatcaatgcc aagctcgatg cgctgacgcc gaagatgatc       480
     gccaacaatg atgcgatgat ggcaatgctc aacgatggcg gcgacgcgct ctcggcttcc       540
     gtcaacgggc ggatcgtctt ctgtttcgtg ctgatcggca tcgccgttct cgccgccgtc       600
     ggcttcagcg tggtcgtcgc ccagaagggc atcgccggcc cgatgacgca gctgcgcctg       660
     cgcatgaccc ggcttgccga gggcgatacg acaagcgatg tcagcggcct cgaccgcggc       720
     gacgaagtcg gccagatggc aaaggcggtt tcggtcttcc gcgacaatgc gatcgagcgc       780
     gcccggatcg aggcgcgcgc cgaaacagac cgcgacgtca gcgacagcga gcgccgcgac       840
     cgcgaggcgc agaaggcccg cgaagcatcg gaactcgacc gcgccgtcac cgcactcggc       900
     gacggcctgc gccgccttgc cgccggcgat ctcgcctcgc atatcgcgga gcccttcgtc       960
     gcgcatctcg atgcgctgcg tgaggatttc aacaactcgg tcgagaagct caacgaaacc      1020
     ctgcatacgg tcggcgccaa tgcccgggcg atcggcgctg gcgccaacga gattcgttcc      1080
     tccgcggacc agctttccca gcggacggaa cagcagtcag cctccgtcga agagacggca      1140
     gcagcgctgg aggagatcac cacgacggtg cgcgacgccg ccaagcgggc cgaggaagca      1200
     agccaactcg tcgcccgcgc ccgcctcggc gccgagaaat ccggcgaggt cgtccgcaag      1260
     gccgtctccg ccatgcagca gatcgagaag tcctcgggcg aaatctccaa catcatcggc      1320
     gtcatcgacg acatcgcctt ccagaccaac cttttggctc tgaacgccgg cgtcgaagcc      1380
     gcccgcgccg gcgatgccgg caagggtttt gcggtcgtcg cccaggaagt gcgcgagctc      1440
     gcccagcgct cggccaaggc ggccaaggag atcaaggcgc tgatcagcac ctccggctcg      1500
     catgtgcaga ccggcgtctc gctggtcggc gaaaccggca aggcgctcga cgcgatcgtc      1560
     caagaggtgc aggagatcaa ccagcacgtc cacgcgatcg ccgaagcctc ccgcgaacaa      1620
     tcgatcgggc tgcaagagat caacaccgcc gtcaacacca tggaccaggg cacgcagcag      1680
     aatgcggcga tggtcgaaga atcgacagcc gccagccata acttggctac ggaagcgtca      1740
     gcgctcaaca atctgctcgg ccaattcagg ctgaccggca ccggcggctt caccacgagt      1800
     actccaatcg ccgcagcagc acctcgcgct gccgcccgcc cggcagccag ggcagccccg      1860
     gtccgcgtcg ctcgcgaagg caccgcccgc ccggccgcct caccggcccg cgcgctcggt      1920
     cagaagatcg ccaacgcctt cggcgccggc agcacatcgc cgagccagga tcccgactgg      1980
     acggaattct ga                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page