(data stored in ACNUC7421 zone)

EMBL: CP001622.PE214

CP001622.PE214       Location/Qualifiers
FT   CDS_pept        227472..228347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0215"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   rec:RHECIAT_CH0000603 probable amino acid ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54526"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A7"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS54526.1"
FT                   /translation="MMQSKLASLTLKGFLAFGLFFGVLFSSLAASAQQVSPSLPLLFDA
FT                   RERLARPDLSSLVRLRFLTSVDFPPFNFTDQNGKLSGFNVDLAREICSELEISDKCQIQ
FT                   AIPFADLRDALAASQGDAVIAGFAVTPELRRQFVFSRPYLMLPARFVRNLAVPLDGKTA
FT                   SALSSHPVGVVRGTVHEAMLAAFFPTLKAEPFDTKDALLAALRDRKVDAAFADALQLSF
FT                   WVSSPASAKCCALFDGPYLSEHFLGEGMTIMLRQKDSVLTSAIDHALATLSRNGRLQEI
FT                   YLRYFPYGLY"
     atgatgcaat ccaagctggc atccctgact ctgaagggtt ttctcgcgtt cggcctgttt        60
     ttcggtgtgc ttttctcaag tttggccgca tcggcccagc aggtgtcccc ctcgctgccg       120
     ttgctcttcg atgcgcgcga acgtcttgcc aggcccgatc tctcctcgct ggtgcgattg       180
     cgcttcctga cgtcggtcga ttttccgccc ttcaatttca ccgatcagaa cggcaagctc       240
     tccggtttca atgtcgatct cgcccgcgaa atctgcagcg agctggaaat atcggacaag       300
     tgccagatcc aggcgatccc cttcgccgac ctcagggatg cgctcgccgc ctcgcagggc       360
     gatgccgtca tcgccggttt tgctgtgacg ccggaactcc gccggcaatt cgtcttctcc       420
     agaccctatc tgatgctgcc ggcgcgcttc gtgcgcaatc tcgccgtgcc gctcgacgga       480
     aagacggctt ccgccctttc cagccacccg gtcggtgtcg tcagggggac ggtgcacgag       540
     gcgatgctgg ccgccttttt ccccacgctc aaggccgagc cgttcgacac aaaggacgcc       600
     ctgctggcgg cgctcagaga ccgcaaggtc gatgccgcct tcgccgatgc gctgcagctt       660
     tccttctggg tttcttcgcc ggcgtcagcc aaatgctgcg cgctgttcga cggcccctat       720
     ctttccgagc atttcctcgg cgagggcatg acgatcatgc tgcggcagaa ggacagcgtg       780
     ctgacgtcag ccatcgacca cgcactcgcc acgctgtcgc gcaacggccg cctccaggaa       840
     atctatctgc gctactttcc ctacgggctt tattga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page