(data stored in ACNUC7421 zone)

EMBL: CP001622.PE215

CP001622.PE215       Location/Qualifiers
FT   CDS_pept        complement(228380..228793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54527"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00534"
FT                   /protein_id="ACS54527.1"
FT                   /translation="MNKPLSAHDALIYVMVMASAVDSTMNDREMERIGQLIGFLPVFRD
FT                   FDDDKLIAVARDCASLLAGPEGLDVVLETVRDTLPAKLYDTAYALAVEVASADLSVKAE
FT                   ELRLLSLLRDRLGLDKLTCAAIERSAIARFRKG"
     atgaacaagc cgctttccgc ccatgatgcg ctgatctacg tgatggtgat ggcatccgcc        60
     gtcgacagca cgatgaacga cagggaaatg gaaaggatcg gccagttgat cggattcctg       120
     ccagttttcc gggatttcga tgacgacaaa ctgattgcgg tggcgcgcga ctgcgcctcg       180
     ctgcttgcag gtccggaagg tctcgacgtc gttctcgaaa ccgtgcgcga caccctcccc       240
     gcaaagctct acgacacggc ctatgcgctg gccgtcgagg tggcatccgc cgatctctcg       300
     gtcaaggcgg aggagttgcg gctgctcagc ctgctgcggg accggctcgg cctcgacaag       360
     ctcacctgtg cggcgatcga gcgcagcgcg attgcccggt tccgcaaggg ctaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page