(data stored in ACNUC7421 zone)

EMBL: CP001622.PE216

CP001622.PE216       Location/Qualifiers
FT   CDS_pept        complement(228896..229606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54528"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000605"
FT                   /protein_id="ACS54528.1"
FT                   /translation="MRPAAFITGITGMVVVTGLLLAGEARLGGGTAGEETASAEETATA
FT                   AVDAASDADEGAAISDDRAEMIARSTEPAASPSPAPGDGVTSKPADLPQQADTAAGQTA
FT                   SPSAKKAVELARPMVDNAGMLSFGERRLQLAGIVPTPVDRICGPAGRQWPCGMMAKTAL
FT                   RLLLRNRSVSCDLETVEWKDTVTTACRLGTEDLGAWLAENGWAEAAVGSPLTAAAEKAR
FT                   QAGKGLYGDDPRRH"
     atgcgccctg ccgccttcat cacaggtatc acggggatgg tcgtggtgac cggcctgctg        60
     ctggcaggcg aagcaaggct tggcggcggc acggctggcg aagagacggc gtccgcggag       120
     gagacggcaa ccgcagcggt ggatgctgcc tccgacgccg acgaaggtgc ggcgatctcg       180
     gacgaccgtg ccgaaatgat cgctcgctca acggaaccgg cggcttcgcc ctctccggcg       240
     ccaggcgacg gggtgacatc caaaccggcc gatctaccgc aacaagccga cacggcggcc       300
     gggcaaacag cgagtccgag cgcgaaaaag gcggtggagc tggcgcggcc gatggtcgac       360
     aatgccggca tgctttcctt tggcgagcgt cggcttcagc ttgccgggat cgtgccgacg       420
     ccggtcgaca ggatatgcgg gccggcgggc cggcaatggc cctgcggcat gatggcgaag       480
     acggcgctgc gcctgttgtt gcgcaaccgc agcgtcagct gcgatctcga gacggtggaa       540
     tggaaggaca cagtaacgac tgcctgccgg ctcggcacag aggatctcgg cgcatggctc       600
     gccgaaaacg gctgggcgga agcagcagtg ggttcgccgc ttacggcggc cgccgaaaag       660
     gccaggcaag caggaaaagg cctttacggc gacgacccgc gccgccatta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page