(data stored in ACNUC7421 zone)

EMBL: CP001622.PE217

CP001622.PE217       Location/Qualifiers
FT   CDS_pept        complement(229618..230295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0218"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000606 putative phage-related
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54529"
FT                   /db_xref="GOA:C6B0B0"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B0"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACS54529.1"
FT                   /translation="MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSAD
FT                   GRLRWPSTESIAKVLDATGASMEQFMAFMRPDAGLSKQPAGQQENAFPPQGGSIPLLGF
FT                   AQAGAGGFFDDGGFPAGQGWDVVEFPAAPSQKAGVYALEVQGESMMPLYRDGDVLIVEP
FT                   GAQVRRNDRVVVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIW
FT                   ASQ"
     atgctgtcac acaaccagat ctgggaagcg ctcgacaggc ttgccgaacg gcacgagctg        60
     acgccatccg gacttgcgcg ccgcgccggc ctcgacccga cctccttcaa caaatcgaaa       120
     cggctttccg ccgatgggcg gctgcgctgg ccttcgacgg aatcgatcgc caaggtgctc       180
     gacgccacag gggcgagcat ggaacagttt atggctttca tgcggccgga cgccggtctt       240
     tccaagcagc cggccgggca gcaggaaaac gcgtttccgc cgcaaggcgg ctccattccg       300
     ctgctcggct tcgcccaggc gggcgccggc ggtttcttcg acgatggcgg ctttccggcc       360
     ggccagggct gggacgtggt ggaatttccg gccgccccgt cgcaaaaggc cggcgtctat       420
     gcgctggagg tgcagggcga gagcatgatg ccgctttatc gcgacggcga cgtgctgatc       480
     gtcgagccgg gggcgcaggt gcgccgcaac gaccgcgtcg tcgtgcgcac aaatgagggc       540
     gaggtgatgg ccaaggtgct gctgcgccag agcccgcggt cgatcgagct gctgtctctc       600
     aatcccgaac atcccaaccg caccctcgag ctttccgacg tcgactggat cgcccgcatc       660
     atctgggcca gccaatag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page