(data stored in ACNUC7421 zone)

EMBL: CP001622.PE218

CP001622.PE218       Location/Qualifiers
FT   CDS_pept        complement(230418..231065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0219"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   rec:RHECIAT_CH0000607 probable two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54530"
FT                   /db_xref="GOA:C6B0B1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54530.1"
FT                   /translation="MHEQTIIIADDHPLFRDALRQAVIGMEGRQSIVEAGDFAAARRAA
FT                   GAHADADLMLLDLAMPGVSGFSGLMALRSEFASLPIVIVSATDDATTIRRALELGASGF
FT                   ISKSSGIDDIRRGIQTVLAGDIATPESYRDGQEQDPDVADLIHRLHTLTPQQSRVLTML
FT                   GEGLLNKQIAYELGVSEATIKAHVSAILLKLDVDSRTQAVIQLGKINMAMVA"
     atgcacgaac agaccatcat cattgcggac gatcatccgc ttttccgtga cgcactgcgc        60
     caggcggtga tcggcatgga aggccggcaa tcgatcgtcg aggccggcga tttcgctgcc       120
     gcgcgccggg ccgccggcgc ccatgcggat gccgatctga tgctgctcga tctcgccatg       180
     cccggcgtca gcggcttttc cggcctgatg gcattgcgct ccgaatttgc cagcctgccg       240
     atcgtcatcg tctcggcaac cgacgacgcg acgaccatcc gccgggcgct ggagctcggc       300
     gcttcaggct tcatttcgaa atcctccggt atcgacgaca ttcgccgcgg catccagacg       360
     gtgcttgccg gcgacatcgc cacgccggaa agctatcgcg acgggcagga gcaggatccc       420
     gatgtcgccg acctgatcca ccgcctgcat acgctgacgc cgcagcagag ccgggtgctg       480
     accatgcttg gcgaagggct gctgaacaag cagatcgcct acgaactcgg cgtctccgaa       540
     gcgacgatca aggcgcatgt ctcggcgatc ctgttgaaac tggacgtcga cagccggacg       600
     caggccgtca tccagctcgg caagatcaat atggcgatgg tcgcctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page