(data stored in ACNUC7421 zone)

EMBL: CP001622.PE219

CP001622.PE219       Location/Qualifiers
FT   CDS_pept        complement(231158..231556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54531"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000608"
FT                   /protein_id="ACS54531.1"
FT                   /translation="MKAFVITLGVFFMPLAAAAAEADAGRFQLEKSGDHFIRLDRQSGA
FT                   MSICQDKDGALVCRMAADERAAYEDELDRLAKRVTALEQGNVAQRALPSDAEVDRSISI
FT                   MERMMKSFMGMVKEFQAEENTNPLPQKT"
     atgaaggcat tcgttatcac gcttggcgtt tttttcatgc cgttggcggc cgcggcggcc        60
     gaagccgatg ccggccgctt ccagctggag aagagcggcg atcatttcat ccggctcgac       120
     cggcagagcg gggcaatgtc gatctgccag gacaaggacg gcgccctcgt ctgccggatg       180
     gcggccgacg agcgggcggc ctatgaggat gaactcgacc ggctggcaaa gcgggtgacg       240
     gcgctagaac agggcaatgt cgcccagcgc gcgctgccga gcgatgccga ggtcgaccgt       300
     tcgatcagca tcatggagcg gatgatgaag agtttcatgg ggatggtgaa ggagttccag       360
     gccgaggaaa acaccaatcc ccttccgcag aagacctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page