(data stored in ACNUC7421 zone)

EMBL: CP001622.PE22

CP001622.PE22        Location/Qualifiers
FT   CDS_pept        complement(20099..21478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0022"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: swi:Swit_0965
FT                   formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54334"
FT                   /db_xref="GOA:C6AYB0"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB0"
FT                   /inference="protein motif:PRIAM:3.5.1.49"
FT                   /protein_id="ACS54334.1"
FT                   /translation="MNSRIDYRKTSAAVSRNFNGFQEPLQKISKWAAVPRIPAHCVRSK
FT                   FACAAPAVAMFLVGSGAFADTSDVKGPRPVIVAKSGEHCKDDPNCFNRVHYAVKPVARV
FT                   KPGQKFILETRDGLDSDLDFSSTAEDVAAVDLNRCHPLTGPVYIEGAKKGDSIAVTVVD
FT                   IEPDEFGTTTVVPGFGFLRDLFTDPYIVHWDLNRLEARSKDMPGISVPNNSFMGTIGVL
FT                   PDKEELQKWLKREQELADAGGAVLTPQPVEALPADLCGVDGTAKSECLRTVPPRENGGN
FT                   VDARETIVGTTILLPCFIDGCGLFAGDVHFAMGGGEVAGTAIETGGRVTLEAQVRPGGA
FT                   KLQTTMHFEGGSQLKQLAPSSFYAISGLPVKSEGELPVFETYLGGEKIAPLANLSEDLT
FT                   LAARNATLNMIDFLVKTKGLTREQAYVLTSVAVDLNIAQVVDYPNVGVTAILNRDVFKE
FT                   Q"
     atgaacagcc gtatcgacta tcgaaagact tcagctgcgg tttccagaaa tttcaacggg        60
     tttcaggagc ccttgcaaaa gatcagcaag tgggctgcgg ttcctcgcat cccagcacac       120
     tgcgtaaggt caaaatttgc atgtgctgca cctgcagttg cgatgttcct tgttggaagc       180
     ggtgccttcg ccgataccag tgacgtcaag gggccaaggc cagtgatcgt cgcgaagtcg       240
     ggcgaacatt gcaaggatga tccaaactgc tttaaccgag ttcactatgc ggttaagcca       300
     gttgcgcgtg tgaagcctgg ccagaaattc attctcgaga cccgtgatgg gctggattcc       360
     gaccttgatt tttcgtcgac cgcggaggac gtcgcggccg tcgacctgaa ccgctgccac       420
     cccctgacgg gccccgtcta tattgaaggg gccaagaagg gcgattctat tgccgtgaca       480
     gtggtggaca tcgagcctga cgaattcggg acgaccacgg tcgttccggg attcggtttc       540
     ctgagagatc tgttcaccga tccatacatt gttcactggg atctgaaccg cctggaagca       600
     cgctccaaag acatgcccgg catctcggtg ccaaacaact ccttcatggg taccattggt       660
     gtgcttccag acaaggaaga acttcaaaaa tggcttaagc gcgagcagga gcttgccgat       720
     gcaggcggtg cagtgctgac gccgcagcca gttgaagcgc taccagcaga tctctgtggc       780
     gtcgatggca cagcaaagtc cgaatgccta cgcaccgttc cgccgcgtga gaacggaggg       840
     aacgttgacg ccagggaaac aattgtcggt acgacgatat tgttgccatg cttcatcgac       900
     ggttgtggtc tgtttgccgg tgacgtccac tttgccatgg gcggcggcga ggtggccgga       960
     accgccatcg agacgggtgg tagggtgaca ctcgaggccc aggtcagacc tggtggtgcc      1020
     aagcttcaga ctacaatgca tttcgaaggc ggttcacagc tcaagcagct tgcgccatcg      1080
     agtttctacg cgatctcagg tctcccggtt aagagtgaag gcgaactgcc tgtttttgag      1140
     acctaccttg gtggtgagaa gattgctccg ctcgcaaacc tctcggagga tctcacgcta      1200
     gcagcgcgaa acgccacgct caacatgatc gattttctgg tcaagaccaa gggactcacc      1260
     cgcgagcagg cttacgttct gaccagtgtc gctgtcgacc tcaacatagc gcaggtcgtc      1320
     gactacccca atgtgggggt tacggcgatc ttgaatcgcg acgtgttcaa ggagcaatga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page