(data stored in ACNUC7421 zone)

EMBL: CP001622.PE220

CP001622.PE220       Location/Qualifiers
FT   CDS_pept        231692..232045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0221"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   ret:RHE_CH00539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54532"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B3"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ACS54532.1"
FT                   /translation="MTLTPTLYKIVTETLWQQARQTGTFHGAGIDLQDGFIHFSTADQV
FT                   KQTAALHFAGQSGLLLIAVDGGGFSDKLVFEPSRGGDLFPHLYADLPLAAVLWEAPLPL
FT                   DEAGAHVFPELQP"
     atgaccctga caccgaccct ttacaagatc gtgacggaaa cgctctggca gcaagccaga        60
     caaaccggca cttttcatgg cgccggcatc gatctccagg acggcttcat ccatttctcg       120
     acggcagacc aggtaaagca gaccgccgcc ctgcattttg ccggccagtc cggcctgctg       180
     ctgattgccg tcgatggtgg cggcttcagt gacaagctgg tcttcgagcc ctcgcgcggc       240
     ggcgatctct tcccgcacct ctacgccgat ctgccgcttg ccgccgtgct ctgggaggcg       300
     ccgctgccgc tcgacgaagc cggcgcccat gtctttccgg agctgcagcc atga             354
//

If you have problems or comments...

PBIL Back to PBIL home page