(data stored in ACNUC7421 zone)

EMBL: CP001622.PE221

CP001622.PE221       Location/Qualifiers
FT   CDS_pept        232042..233130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0222"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="KEGG: ret:RHE_CH00540 dihydroorotate dehydrogenase
FT                   2; TIGRFAM: dihydroorotate dehydrogenase; PFAM:
FT                   dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54533"
FT                   /db_xref="GOA:C6B0B4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B4"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ACS54533.1"
FT                   /translation="MIDPFKRLARKGLFLFDPETAHGMSIAALKSGLVPACQITPDPRL
FT                   RQTVAGLTFENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQSGNPRPRIFRLV
FT                   EDEAVINRLGFNNEGHDAAFGHLAALRGGGMIGVNIGANKDSEDRIADYVAGIRRFYSV
FT                   ARYFTANISSPNTPGLRDLQGRESLAVLLSAVLAARDEMAAASGRTIPVFLKIAPDLTE
FT                   EGMDDIAAEALSHGLDGLIVSNTTLSRDGLKDQRQAKEAGGLSGVPLFEKSTAVLARMR
FT                   KRVGPDLPIIGVGGVSSAETALEKIRAGADLVQLYSCMVYEGPGLAGDIVRGLSKLLDR
FT                   EKAASIRDLRDVRLDYWAARKV"
     atgatcgatc ccttcaagcg tctcgcccgc aagggtctct tcctgttcga tccggaaacg        60
     gcgcacggca tgtcgatcgc cgccttgaaa tccggtctcg tgcccgcctg ccagatcacc       120
     cccgatccgc gcctgcgcca gaccgttgcc ggccttacct tcgaaaatcc gctcggcatg       180
     gccgccggct acgacaagaa tgccgaggtg ccggaggcgc tgctgaagct cggtttcggc       240
     tttaccgaga tcggtacggt gacgccgaag ccgcaatccg gcaatccgcg cccgcgcatc       300
     ttccgcctgg tcgaggatga agccgtcatc aaccgcctcg gcttcaacaa tgaaggccat       360
     gatgccgcct tcgggcacct cgccgcgctg aggggcgggg gcatgatcgg cgtcaatatc       420
     ggcgccaaca aggatagcga ggaccgcatc gccgattatg tcgccggcat ccgccgcttt       480
     tattccgtcg cgcgctattt caccgccaac atctcctcgc cgaacacccc cggcctgcgc       540
     gacctgcagg ggcgcgaaag ccttgcggtg ctgttatcag ccgtgcttgc ggcgcgtgac       600
     gaaatggcag cggcatccgg ccggacgatc ccggtctttc tgaagatcgc gcctgatctg       660
     accgaggaag gcatggacga tatcgcagcc gaggcgcttt cgcatgggct cgacgggctg       720
     atcgtctcca acaccacgct gtcgcgcgac ggcctcaagg atcagcgcca ggcgaaggag       780
     gcgggtggac tttccggcgt gccgcttttc gaaaagtcga cggcggtgct cgccaggatg       840
     cgcaagcgcg tcggccctga tctgccgatc atcggcgtcg gtggcgtctc ctcggccgag       900
     accgcgctgg agaagatcag ggcgggcgcc gatctcgtcc agctctattc ctgcatggtc       960
     tatgaaggcc ccggtctggc cggcgatatc gtccgcggcc tgtcgaaact cctggaccgc      1020
     gaaaaggccg cctcgatccg cgacctgcgt gatgtcaggc tggattattg ggcggcgcgg      1080
     aaggtctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page