(data stored in ACNUC7421 zone)

EMBL: CP001622.PE222

CP001622.PE222       Location/Qualifiers
FT   CDS_pept        complement(233106..234452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0223"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: ret:RHE_CH00541
FT                   DNA-damage-inducible F protein (Na+ driven multidrug efflux
FT                   pump)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54534"
FT                   /db_xref="GOA:C6B0B5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B5"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACS54534.1"
FT                   /translation="MDTRSNHNALAFDVTHLMVLSIALPMTLGFMTTPLLGLTNTAVVG
FT                   RMGNAEALAGLAIGAMLFDLILGSFNFLRASTTGLTAQAYGRHDQHEQQAVFFRAMISA
FT                   LGCGLALLCLSPLLMTAGLRLMGAEGAIAEATSTYFSIRMLAAPAALANYAILGFVLGR
FT                   GQGKIGLLLQAIINGINILLSIYLGLTLDWGVAGVAWGTMAGESVGALAGLFIVLNGFG
FT                   KAARPAWAEIFSRHRLAELFALNRDILIRTFVLIGAFTIMTRIGTSFGAVTLAANAVVM
FT                   NFFLLSGYYLDGLANAAEQIIGRAIGAHYRPAFDRGLKLTTLWSFGLAALGSAVFFLAG
FT                   PWLISVLTTSPDVRQAAETYLPWAAVTGLTGALAFVMDGVFIGATWSADMRNRMLISFA
FT                   GYLMMLAIFVPLFGNHGLWLAMNAFLLFRGFFLAMLVRSRADQTFRAAQ"
     atggatacac gcagcaatca caacgcgctt gcattcgacg tgacgcacct gatggtgctg        60
     tcgatcgccc ttccgatgac gctcggcttc atgacgacgc cgctgctcgg gctgacgaac       120
     accgccgtcg tcggccgcat gggcaatgcg gaagcgctgg ccgggctggc gatcggcgcg       180
     atgctcttcg atctgatcct cggcagcttc aacttcctgc gcgcttcgac aaccgggctg       240
     acggcgcagg cctatggccg tcacgaccag cacgagcagc aggcggtctt ttttcgggcg       300
     atgatttcgg cgctcggctg cggactggcg ctgctctgtc tttcgccact gctgatgacg       360
     gcggggttaa ggctgatggg ggcggaaggg gcgatcgccg aggcaaccag cacctatttt       420
     tcgatccgca tgctggccgc acccgcggca ctggcgaatt atgccatcct cggcttcgtg       480
     ctcgggcgcg gacagggcaa gatcggactt ctgctgcagg cgatcatcaa cggcatcaac       540
     atcctgcttt ccatctatct cggcctgacg ctcgattggg gcgtggcggg ggtcgcctgg       600
     ggcaccatgg ccggcgaaag cgtcggcgcg ctcgccgggc ttttcatcgt gctcaacggc       660
     ttcggcaagg cagcccggcc ggcatgggcg gagatctttt cccggcaccg gctggccgag       720
     cttttcgcgc ttaaccgcga catcctgatc cgcactttcg tgctgatcgg agccttcacc       780
     atcatgacgc ggatcggcac cagcttcggc gcggtgacgc ttgccgccaa tgccgtggtg       840
     atgaatttct tcctactatc aggctattat ctcgacgggc ttgccaatgc cgccgaacag       900
     atcatcggcc gggcgatcgg cgcgcattac cggccggcct tcgaccgcgg gctgaagctg       960
     acgaccttgt ggtccttcgg actggcggcg ctcggctccg ccgtcttctt cctcgccggc      1020
     ccctggctga tctcggtgct gacgacctca cccgatgtgc ggcaggcggc cgaaacctat      1080
     ctgccctggg cggcggtcac aggactgacc ggcgcgctcg ccttcgtgat ggacggggtc      1140
     ttcatcggcg ccacgtggtc ggccgacatg cgcaaccgga tgctgatctc ttttgccggt      1200
     tatctcatga tgctcgcgat cttcgtgccg ctgttcggca atcatggcct gtggctggcg      1260
     atgaacgcct tcctgctctt ccgcggtttc ttcctggcga tgctggtgcg gtcgcgggcc      1320
     gatcagacct tccgcgccgc ccaataa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page