(data stored in ACNUC7421 zone)

EMBL: CP001622.PE223

CP001622.PE223       Location/Qualifiers
FT   CDS_pept        complement(234538..235035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0224"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG:
FT                   rec:RHECIAT_CH0000612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54535"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B6"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ACS54535.1"
FT                   /translation="MTSIDLSRRGLLRLSGLALAAGIAGCTTTPRMAGTPSDGEDETAS
FT                   VLPLVNQLRAKNGLPPLTVDPAASTAALFQAKRMASAGKMAHLMGMTDSFGARVKASGV
FT                   RLPAAENIASGQQSVDAVVTAWINSPHHLENMLGRYGGLGVAVAHNTSSRNLPYWAMVL
FT                   SS"
     atgacatcca tcgatctttc caggcgcggc ctgctgcgcc tttccggact tgcgctcgcc        60
     gccggcatcg ccggctgcac cacgaccccg cggatggccg gcacgccgtc ggacggcgag       120
     gacgagacgg cgagcgtgct gccgctcgtc aaccagctca gggccaaaaa cggcctgccg       180
     ccacttaccg tcgatccggc ggcgagtact gccgccttgt tccaggcaaa acgcatggcg       240
     agtgcgggca aaatggccca tctcatgggt atgaccgaca gtttcggcgc gcgcgtcaag       300
     gcaagcggcg tgcggctgcc ggcggctgag aacatcgcct ccggccagca gagcgtcgat       360
     gctgtggtga cggcctggat caactcgccg catcacctgg aaaacatgct cggacgttat       420
     ggcggccttg gcgtcgccgt cgcccataat acatcttcca ggaacctgcc ctattgggcc       480
     atggtgcttt ccagctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page