(data stored in ACNUC7421 zone)

EMBL: CP001622.PE224

CP001622.PE224       Location/Qualifiers
FT   CDS_pept        complement(235037..235303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54536"
FT                   /db_xref="GOA:C6B0B7"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000613"
FT                   /protein_id="ACS54536.1"
FT                   /translation="MSDQANRFLGDSIGRTLIKLIVVSLIVGFVMTVFGLTPWGIIYGI
FT                   RDFIQEIWYRGFSALGRVGDYLLLGATIVIPLFIILRLFSYRR"
     atgtccgatc aggcgaacag gttcctcggt gattcgatcg gccgcacatt gataaagctt        60
     atcgtggtgt cgctgatcgt cggtttcgtc atgaccgtct tcggcctgac gccgtggggc       120
     atcatctacg gcatacgcga tttcatccag gagatctggt accgcggctt ctcggcgctt       180
     gggcgcgtcg gcgactatct cctcctcggt gcgacgatcg tcatcccgct cttcatcatc       240
     cttcgtcttt tcagctaccg ccggtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page