(data stored in ACNUC7421 zone)

EMBL: CP001622.PE225

CP001622.PE225       Location/Qualifiers
FT   CDS_pept        235505..236440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0226"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; KEGG: rec:RHECIAT_CH0000614 probable
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54537"
FT                   /db_xref="GOA:C6B0B8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACS54537.1"
FT                   /translation="MQPHQLSSGDVIADRRADYARMLEEGGEPEAAAELMEQALELVPA
FT                   WAAGWYRLATYLEKAGRGEAAIEAYRRTLALGPDDIFGAALKLALLGDGAVPPDRPPSR
FT                   YVERLFDDYADRFESALVEKLDYSVPQKLAALIASTGRRYERAVDLGCGTGLLGPEIRA
FT                   NVDRLEGFDLSQNMLAKAAEKHVYDSLAQADLSLAPDLSVVFADAARHRADLVTAADVL
FT                   MYLGNLESVFAIVGELAASGADIAFSVEDAGEGDGFHLAPSLRYAHSESYVRMLLARHG
FT                   FQILKTVKSVIRKDGGKPVSGILFLTQKPA"
     atgcagcccc accagctttc ctcaggcgat gtcatcgccg accgccgcgc cgattatgcc        60
     cggatgctcg aagaaggcgg cgagccggaa gcggccgccg agctgatgga gcaggccctc       120
     gagctcgtgc ctgcctgggc cgccggctgg tatcgcctcg ccacctacct ggaaaaggcg       180
     ggcaggggtg aagccgcgat cgaggcctat cgcaggacgc ttgctctcgg tcccgatgac       240
     attttcggcg ccgccctcaa gctcgccctt ctcggtgatg gcgccgtgcc tcctgaccgg       300
     ccgccgagcc gctatgtcga gcgcctcttc gacgactatg ccgaccgttt cgaatcagca       360
     cttgtcgaaa agctcgacta cagcgtcccg cagaaactgg ccgcgcttat cgcctccacc       420
     ggcaggcgct acgaacgcgc cgtcgatctc ggctgcggca ccggcctgct cggcccggag       480
     atccgggcca atgtcgaccg cctcgaaggc ttcgatctct cgcagaacat gctggcgaag       540
     gccgccgaga aacatgtcta tgacagtctc gcccaggccg atctctcgct cgcgcccgat       600
     ctctccgtcg tctttgccga tgccgcgcgc catcgcgccg acctggtgac ggcagccgat       660
     gtgctgatgt atctcggcaa tctcgagagc gtctttgcca tcgtcggaga actcgctgca       720
     tcaggcgccg acatcgcctt ttccgtcgag gatgcaggtg agggcgacgg ctttcacctc       780
     gctccctctc tgcgctacgc ccattcggaa agctatgtca ggatgttgct tgcccgtcac       840
     ggcttccaaa tcctcaagac cgtcaagtcg gtcattcgca aagatggcgg aaaaccggtt       900
     tccggcattc tgttccttac gcagaagccg gcgtga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page