(data stored in ACNUC7421 zone)

EMBL: CP001622.PE226

CP001622.PE226       Location/Qualifiers
FT   CDS_pept        236652..237287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0227"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   ret:RHE_CH00545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54538"
FT                   /db_xref="GOA:C6B0B9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B9"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACS54538.1"
FT                   /translation="MTQLINALGFWNTTATRHTPIEDVQGIFSGSLVAALGLYVLASAG
FT                   LLTGSTAGVAFLLHYAFGVNFGLAFFLLNLPFFYLSWKRLGMAFTIKTFIAIGLTSVIA
FT                   DVQSRFLSISSIHPAWAALLGGLLLGFGLLALYRHRASLGGVGILGIYLQERFGIRAGL
FT                   VQLAIDMCVLAAAFFVTTPPVVFYSVLGAVVLNLFVAINHRADRYIAL"
     atgacacagc tcatcaatgc ccttggcttc tggaatacga ctgcgacgcg ccacacgccg        60
     atcgaagacg tgcagggcat attctccggc agcctcgttg ccgctctcgg cctctacgtg       120
     ctcgccagcg ccggccttct cactggcagc acggccggcg tcgctttcct cctgcattat       180
     gccttcggcg tcaatttcgg gcttgccttc ttcctgctca acctgccgtt cttctatctc       240
     tcctggaagc gcctcggcat ggccttcacc atcaagacct tcatcgccat cggcctgacc       300
     tcggtgattg ccgacgtgca gtcgcgcttc ctgtccattt cgagcatcca tccagcctgg       360
     gcggcccttc tcggcggcct gctgctcggc ttcggcctgc tggcgctcta tcgccaccgc       420
     gccagcctcg gcggtgtcgg cattctcggt atctacctgc aggagcggtt cggcatccgc       480
     gccggcctcg tccagctcgc catcgatatg tgcgtgctcg ccgccgcctt cttcgtcacc       540
     acgccgcctg tcgtctttta ttcggttctc ggcgccgtcg tcctcaacct cttcgtcgcc       600
     atcaatcacc gcgctgatcg ctacatcgcg ctttag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page