(data stored in ACNUC7421 zone)

EMBL: CP001622.PE228

CP001622.PE228       Location/Qualifiers
FT   CDS_pept        complement(237674..238135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0229"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rec:RHECIAT_CH0000617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54540"
FT                   /db_xref="GOA:C6B0C1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C1"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACS54540.1"
FT                   /translation="MQPRFNFAKAAPDAYKAVAALEQYVQSSGLERRFIHLIKLRASQI
FT                   NGCAYCVDMHVKEARHDGLSEQWINLMCVWRESPVYDARERALLGWVDSVTNIAKTGAP
FT                   DADYETLKAHFSEEEMTKITVAIGAINIWNRLAVGFRSQHPLDAAAKAA"
     atgcaaccac gtttcaattt cgccaaagcc gctcccgatg cctacaaggc agtcgccgcg        60
     ctcgagcaat atgtccagtc ctccgggctg gagcgccgct tcatccacct gatcaagctg       120
     cgcgcctcgc agatcaacgg ctgtgcctat tgcgtcgaca tgcatgtgaa agaagcccgc       180
     catgatggac tctccgaaca atggatcaac ctgatgtgcg tctggcggga atcgcctgtc       240
     tatgacgccc gcgaacgggc gctgctcggc tgggtggatt ccgtgaccaa tatcgccaaa       300
     acaggggcgc ctgatgccga ctacgagacg ctgaaggcgc atttttccga ggaagagatg       360
     acaaagatca cggtggcgat cggcgcgatc aacatctgga accggcttgc cgtcggcttc       420
     cgctcgcagc atccgctcga tgcggcagcg aaggccgcct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page