(data stored in ACNUC7421 zone)

EMBL: CP001622.PE229

CP001622.PE229       Location/Qualifiers
FT   CDS_pept        complement(238158..238658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0230"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; Helix-turn-helix
FT                   type 11 domain protein; KEGG: rec:RHECIAT_CH0000618
FT                   putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54541"
FT                   /db_xref="GOA:C6B0C2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C2"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACS54541.1"
FT                   /translation="MKIGDGVEQAIHSVAMLSGLSEGGVLSAAALAEFHGVSTSYLLKH
FT                   LQALSGAGILDTVPGPKGGYRLAKAPKEISLLDIVLAVEGSAPAFRCAEIRQRGPNPVS
FT                   DRLFAQPCTINAAMLKAERVYRAELAKTSLADIGIELAAVDDGSIAARGCAFLEIHERK
FT                   TAR"
     atgaagatag gcgatggggt cgagcaggcc attcacagcg ttgcgatgct ttccggcctc        60
     tccgaaggcg gcgtgctttc ggcggccgcg ctggcggaat tccacggcgt ttcgacgagt       120
     tatctgctga agcatctgca ggcgctgtcg ggcgccggca tcctcgatac cgtaccgggg       180
     ccgaagggcg gatatcggct agcaaaggcg ccgaaggaga tttcgctgct cgacatcgtg       240
     ctcgcggtcg aggggtctgc accggcgttc cgctgcgccg aaatccgcca gcgcggaccg       300
     aacccggtct ccgatcgctt gttcgcccag ccctgcacca tcaacgcggc gatgctgaaa       360
     gccgaacggg tctatcgcgc cgaactcgcc aagacgagcc tggcggatat cggcatcgaa       420
     cttgccgccg tcgacgacgg atcgatcgca gctaggggct gcgccttcct tgaaatccat       480
     gaacgcaaga cggctcgttg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page