(data stored in ACNUC7421 zone)

EMBL: CP001622.PE23

CP001622.PE23        Location/Qualifiers
FT   CDS_pept        complement(22088..22723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0023"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   sbl:Sbal_4073 (acyl-carrier-protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54335"
FT                   /db_xref="GOA:C6AYB1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB1"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACS54335.1"
FT                   /translation="MRVLHVSCSPRGEASESYRLSQQIISQLRQSDPDTTVIDRVIGQG
FT                   VIPPIDEDYAVSQGSSKDVSQLGSMAKSEELILELETADVVVISTPMHNLTLPATLKLW
FT                   IDHIVRTRRTFNISKFGKVGTLQDRPVFVAISSGGRFSGEHPQQPDFLTPYLTAILGMI
FT                   GLHNVAIFSVQGTGSHVNELASIRRNTDQLVREHFASFHPDLIAVPTY"
     atgagagtgc ttcatgtcag ctgcagtcct cgcggggaag catccgagag ctatcgactc        60
     tcgcaacaga tcatcagcca gttgcggcag agcgatcccg acacaacggt aatcgaccgt       120
     gtgattggcc aaggcgtcat cccgccgatc gacgaggatt acgcggtttc ccaaggctcc       180
     tccaaagacg tgtctcaact cggatccatg gccaagtctg aggagttgat actggagctg       240
     gaaactgcgg acgtcgtggt catttctacg ccaatgcata atttgacgct ccccgcgacc       300
     ttgaagttgt ggatcgatca tatcgttcga acgcggagga ccttcaatat cagcaagttt       360
     ggaaaggtcg ggacgctaca ggatcgcccc gtcttcgtcg ccatctcctc gggcggtcga       420
     ttctccggtg agcacccgca gcaacccgac tttctcacgc catacctgac agcaatccta       480
     ggcatgatcg gcctacataa cgtagcgata ttctcggtcc aaggaacagg ctcgcacgtc       540
     aatgagcttg cttcgataag acgcaacacg gatcaattgg tccgagaaca ctttgcctct       600
     ttccatcccg atctgatcgc ggtgccaact tactga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page