(data stored in ACNUC7421 zone)

EMBL: CP001622.PE230

CP001622.PE230       Location/Qualifiers
FT   CDS_pept        238791..239423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0231"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   rec:RHECIAT_CH0000619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54542"
FT                   /db_xref="GOA:C6B0C3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C3"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACS54542.1"
FT                   /translation="MASNAFAGLLNSSADRHSLFDDAQGIVAGSMLAVLGVTLLSSAGL
FT                   LAGGTAGLAFLAHYATGFSFGLCFFVVNLPFYYLAFRRLGLAFTIKTFAAIALTSVLSE
FT                   FISGFVSMAHVDPIAGALFGGLVIGAGMLALFRHRASLGGIGILALYIQDRLGWRAGFV
FT                   QLGFDGTILALSFFVASPFIIACSVLGAIVLNLTIAINHRKDRYIAM"
     atggcatcca acgcttttgc aggccttctg aattccagcg ccgaccgtca ttcgctcttc        60
     gacgacgccc agggcatcgt tgccggcagc atgctcgccg tgctcggcgt aacgcttctc       120
     tccagcgccg ggctgcttgc cggcggcacg gcgggccttg ccttcctcgc ccattatgcg       180
     acgggcttca gcttcggcct ctgcttcttt gtcgtgaact tgcccttcta ttatctcgcc       240
     ttccgccgct tgggcctcgc cttcaccatc aagaccttcg cggccatcgc gctgacctcg       300
     gtcctgtcgg aattcatctc gggctttgtc agcatggcgc atgtcgatcc catcgccggc       360
     gcgctcttcg gcggcctcgt catcggcgcc ggcatgctgg cgctcttccg ccaccgcgcc       420
     agcctcggcg gcatcggcat tcttgccctc tatatccagg atcgcctcgg ctggcgcgcc       480
     ggcttcgtcc agctcggctt cgacggcacc atcctggcgc tctccttctt cgtcgcaagc       540
     cccttcatca tcgcctgctc cgtgcttggc gcgatcgttc tcaacctgac gattgccatc       600
     aaccaccgca aggaccgcta tatcgccatg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page