(data stored in ACNUC7421 zone)

EMBL: CP001622.PE231

CP001622.PE231       Location/Qualifiers
FT   CDS_pept        239420..241981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0232"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: DEAD/H associated domain protein; DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000620 ATP-dependent RNA/DNA helicase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54543"
FT                   /db_xref="GOA:C6B0C4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C4"
FT                   /inference="protein motif:PFAM:PF08494"
FT                   /protein_id="ACS54543.1"
FT                   /translation="MKARGSSFSLAFHYLPGVDQIDSEARTLLPAAFTRWFAEKGWRPR
FT                   AHQLELLARAEAGESTLLIAPTGAGKTLAGFLPSLTDLTRRGKIPPGSAFTGIHTLYVS
FT                   PLKALAIDIERNLMKPVEEMGLPVTVENRTGDTPNAKRQRQKLNPPDILLTTPEQVALL
FT                   LANREAERFFKDLKYIVLDELHSLVTSKRGHMLSLGLARLRRLAPGLKTIGLSATVAEP
FT                   MDLQKWLVGQEEGGEHHAGLVVVEGGAKPDISILSTEERIPWAGHSARYAIPDVYNKLV
FT                   EHRTTLLFVNTRSQAEMLFQALWTINDDNLPIALHHGSLDVAQRRKVEAAMAENRLRAV
FT                   VATSTLDLGIDWGDVDLVIHVGAPKGASRLAQRIGRANHRMDEPSKAILVPANRFEVME
FT                   CQAALDANYIGAQDTPPVGRGALDVLAQHVLGMACAEPFDMLELYDEIISASPYADLSW
FT                   ETFERIIDFVATGGYALRTYERYARIRKTAEGRWRVSNPAVAQQYRLNLGTIVESPMLN
FT                   IRMVKRGEGGRIGRGGATLGKVEEYFLEQMSPGDTFVFSGKVLRFEGIRENECLASQAF
FT                   SLDPKIPSYNGGKFPLSTYLAEQVRAMIADPDRWRRLPDQVRDWLSLQNDKSMLPKRDE
FT                   FLIETFPRGSRGYMVAYPFEGRLAHQTLGMLLTRRLERIGAKPLGFVATDYSLAVWGLE
FT                   DMGLMIRNGRLNLSDLFDEDMLGDDLEAWLDESFLLKRTFRNCAVIAGLIERRHPGKEK
FT                   SGRQITVSADLIYDVLRSHEPDHILLQATRQDAATGLLDIGRLGDMLRRIRGHITHRAL
FT                   DHISPLAVPVMLEIGREAVPGEAHDALLAEAADDLIAEALA"
     gtgaaggcgc gcggctcttc tttttccctg gcatttcact accttccagg cgtggaccag        60
     atcgattccg aagcccgcac actgcttcct gccgccttta cccgctggtt tgcggaaaag       120
     ggctggcgcc cgcgtgccca tcagttggaa ctgcttgccc gcgccgaggc cggcgaaagc       180
     acgctgctga ttgcgccgac cggcgccggc aaaacgctcg ccggtttcct gccctcgctc       240
     accgatctca cccgccgcgg caaaatcccg cccggctccg ccttcaccgg catccacacg       300
     ctctatgtct cgccgctgaa ggcgcttgcc atcgatatcg aacgcaacct gatgaagccg       360
     gtcgaggaga tgggcctgcc ggtcaccgtc gaaaaccgca ccggcgacac gccgaacgcc       420
     aagcgccagc gccagaagct caacccgccg gatattctgc tgacgacgcc ggaacaagtc       480
     gccctgcttc tggcaaaccg ggaggccgag cgcttcttca aggacctgaa atatatcgtc       540
     ctcgacgaac tgcattcgct ggtcacctcc aagcgcggcc atatgctttc gctcggcctt       600
     gcgcgtctcc gccgccttgc ccccgggctc aagaccattg gtctgtcggc caccgtcgcc       660
     gagccgatgg acctgcagaa atggctggtc ggccaggaag agggtggcga acatcatgcc       720
     ggcctcgtcg tcgtcgaagg cggcgccaaa cccgatatct cgatcctgtc gaccgaagag       780
     cgcatcccct gggccggcca ttccgcccga tatgccattc cagatgtcta caacaagctc       840
     gtcgaacatc gcacgacgct gctcttcgtc aacacccgca gccaggcgga aatgctattc       900
     caggcgctct ggacgatcaa tgacgacaac ctgccgatcg ccctccacca cggctcgctc       960
     gatgtcgccc agcgccgcaa ggtcgaggcg gcgatggccg aaaaccggct gcgcgccgtc      1020
     gtcgccacct ctaccctcga tctcggcatc gactggggcg atgtcgatct cgtcatccat      1080
     gtcggcgcgc cgaagggcgc ctcgcgcctt gcccagcgca ttggccgcgc caatcaccgc      1140
     atggacgagc cctcgaaggc gatcctcgtg ccggccaacc gtttcgaggt catggagtgt      1200
     caggcagccc tcgacgccaa ttatatcggc gcacaggaca ccccgccggt cgggcgcggc      1260
     gcgctcgacg tgctcgccca gcatgtgctc ggcatggcct gcgccgaacc tttcgacatg      1320
     ctggaactct acgatgaaat catcagcgcc tcgccctatg ccgatctgag ctgggagacc      1380
     ttcgagcgca tcatcgattt cgtcgcgacc ggcggttatg cgctccgcac ctatgagcgc      1440
     tacgcccgta tccgcaagac tgcggagggc cgctggcgcg tctccaaccc tgcagtcgcc      1500
     cagcaatatc gcctcaacct cggcaccatc gtcgaaagcc cgatgctgaa tatccgcatg      1560
     gtcaagcgcg gcgagggcgg caggatcggc cgcggcggcg cgacactggg gaaggtcgag      1620
     gaatatttcc tcgagcagat gtcgccgggc gataccttcg tcttctccgg caaggtgctg      1680
     cgcttcgagg gtattcgcga aaatgagtgc ttggcgtcgc aggccttttc gctcgatccg      1740
     aagatcccct cctataatgg cggcaaattt ccgctgtcga cctatctcgc cgagcaggtg      1800
     cgggcgatga tcgccgatcc cgaccgctgg cgccgcttgc cggatcaggt gcgcgactgg      1860
     ctgtcgctgc agaacgacaa gtcgatgctg ccgaagcgcg acgagttcct gatcgaaacc      1920
     ttcccgcgcg gcagccgcgg ctatatggtc gcctatccct tcgaaggccg tctcgcccac      1980
     cagacgctcg gcatgctgct cacccgccgg ctggagcgga taggcgccaa gcccctcggt      2040
     ttcgtcgcca ccgattattc ccttgccgtc tggggcctcg aggatatggg cctgatgatc      2100
     cgcaatggcc ggctcaacct ctccgacctc ttcgacgagg acatgctcgg cgacgatctc      2160
     gaagcctggc tggacgaatc cttcctgttg aagcgcacct tccgcaattg cgccgtgatt      2220
     gcaggcttga tcgagcgccg ccatccgggc aaggaaaaga gcggccgcca gatcaccgtc      2280
     tcggccgatc tgatctacga cgtgttgcgc agccacgaac cggatcacat cctcctgcag      2340
     gcgacgcggc aggatgcagc gacgggactt ttggatattg gccgtcttgg cgatatgctg      2400
     agacgaatca ggggccacat cacccaccgc gccctcgacc atatttcccc gctcgccgtg      2460
     ccggtgatgc tggaaatcgg acgcgaggcg gtgccgggcg aggcccatga tgcactgctc      2520
     gccgaagcgg cggacgatct gatcgccgag gcgctcgctt ga                         2562
//

If you have problems or comments...

PBIL Back to PBIL home page