(data stored in ACNUC7421 zone)

EMBL: CP001622.PE232

CP001622.PE232       Location/Qualifiers
FT   CDS_pept        242024..242749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0233"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   rec:RHECIAT_CH0000621 putative phosphoesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54544"
FT                   /db_xref="GOA:C6B0C5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS54544.1"
FT                   /translation="MNRLALARDISGLAAIPGIETSVNGIAAVCDPLGALYLPDAGLLV
FT                   VSDLHLEKGAAFARRGMMLPPYDTLATLTVLAAVISRYDPKLVISLGDNFHDRIGSKHL
FT                   PENFRTLIVNMARGREWIWINGNHDPDGIVDLPGTSADEMHYAGLTFRHEPKNGLQSGE
FT                   IAGHLHPSATVRRREKSVRRPCFATDGARLLMPAFGLMSGGLDLGHQAMKGLFDKALLV
FT                   AHLLGRDRIYSVRYGNLRG"
     atgaaccgcc tggcgctcgc gcgcgacatt tcaggactgg ccgcgatacc aggcatcgag        60
     acatcggtga acggcattgc cgccgtctgc gatccgctcg gcgccctcta tctgccggat       120
     gccggcctgc tcgtcgtctc cgacctgcat ctggaaaagg gcgcagcctt cgcgcgccgc       180
     ggcatgatgc tgccgcctta cgatacgctg gcgacgctga ccgtccttgc cgccgtcatc       240
     tcgcgttatg atccgaagct cgtcatctcg ctcggcgaca atttccacga ccgcatcggt       300
     tccaagcatc tgccggagaa tttccgcacg ctgatcgtca atatggcccg cggccgcgaa       360
     tggatctgga tcaatggcaa ccatgatccg gatggcatcg tcgatctgcc gggcacatct       420
     gccgacgaga tgcattatgc cggcctgacc tttcggcacg agccgaagaa cggcttgcaa       480
     agcggcgaga tcgccggcca cctgcacccg tcggcgacgg tccgccgccg cgagaaatcc       540
     gtccgccgcc cgtgctttgc caccgacggc gcccgcctgc tgatgccggc cttcggcctc       600
     atgagcggcg gtctggatct cggccatcag gcgatgaagg gcctgttcga caaggctttg       660
     ctggtggcgc atctgctggg gcgggatcgg atttattcgg tcagatatgg gaacttgagg       720
     gggtag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page