(data stored in ACNUC7421 zone)

EMBL: CP001622.PE233

CP001622.PE233       Location/Qualifiers
FT   CDS_pept        complement(242782..243363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54545"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00551"
FT                   /protein_id="ACS54545.1"
FT                   /translation="MRTRIVLTAVGLALLAGCATAPKQTRNICAVFDERDGLFSSWQSA
FT                   AERTEKKYGVPVPILMATMYTESGFQPYARPPRTKLFGFIPWTRPSTAYGYSQALDGTW
FT                   DHYQSQTGNWTARRANFADAIDFIGWYHYQNSVETGIPLNDAYNLYLAYYSGPTGYKRG
FT                   DWRSNGQLQQTAQKFARMAGTYQRQLQECD"
     atgcgtactc gtatcgttct gacggccgtg ggtctcgcgc tgcttgccgg ctgcgcgacg        60
     gcgccgaagc agacgaggaa catctgtgcc gtcttcgacg agcgcgacgg gcttttctcc       120
     agctggcaga gtgccgccga gcggacggag aagaaatacg gcgtgcccgt gccgatcctg       180
     atggcgacga tgtataccga atccggcttc cagccctatg cgcggccacc acgcaccaag       240
     ctgttcggct tcattccctg gacccggcct tcgaccgcct acggttattc tcaggcgctc       300
     gacgggactt gggatcacta tcagtcgcag accggcaact ggaccgcgcg gcgggcgaac       360
     ttcgccgacg cgatcgattt catcggctgg tatcactacc agaacagcgt ggagaccggc       420
     attccgctga acgatgccta taatctctat ctcgcctatt attccgggcc gacgggatac       480
     aaacgcggcg actggcgctc gaacgggcag ttgcagcaga cggcgcagaa gtttgcgcgg       540
     atggcaggga cgtatcagcg gcagctgcag gagtgcgatt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page