(data stored in ACNUC7421 zone)

EMBL: CP001622.PE234

CP001622.PE234       Location/Qualifiers
FT   CDS_pept        complement(243512..244069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0235"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rec:RHECIAT_CH0000623 putative dihydrofolate
FT                   reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54546"
FT                   /db_xref="GOA:C6B0C7"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C7"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACS54546.1"
FT                   /translation="MRKLIVWNLMTLDGYFEGTKPWDIDFHNLAWGPELQRYAEQFGRE
FT                   SDLLVFGRKTYEGMASYWPTAEGEGEIKTYMNGIAKIAVSRTMSEPGWNNARVVSDPIP
FT                   ELTRLKQEDGKTILIFGSAELADSLLKAGLIDEVRVCLVPVILGGGNPLFKQAEGQLPL
FT                   KLIESSTTEGGAVILRYEPVKA"
     atgagaaagc ttatcgtctg gaacctgatg acgctcgatg gttatttcga aggcacgaag        60
     ccgtgggata tcgacttcca caatctcgcc tgggggcctg aattgcagcg ctatgccgaa       120
     cagttcggta gggaaagcga tctgctggtc ttcggccgca agacctatga gggcatggcc       180
     tcctactggc cgaccgccga gggcgaaggt gagatcaaaa cctatatgaa cggcatcgca       240
     aagatcgccg tgtcgcggac gatgagcgag cccggctgga acaatgcccg cgtcgtcagc       300
     gatccgatcc ccgaattgac caggctgaag caggaggatg gcaagacgat cttgatcttc       360
     ggcagcgccg agcttgccga tagcctgctg aaagcggggc ttatcgacga agtcagggtt       420
     tgcctggtgc cggtgatcct cggcggcggc aatccgcttt tcaaacaggc agagggccag       480
     ctgccgctga agctcatcga atcctcgaca acggagggcg gcgcggtgat cctgcgctac       540
     gagcccgtca aggcgtag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page