(data stored in ACNUC7421 zone)

EMBL: CP001622.PE235

CP001622.PE235       Location/Qualifiers
FT   CDS_pept        complement(244271..245071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54547"
FT                   /db_xref="GOA:C6B0C8"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000624"
FT                   /protein_id="ACS54547.1"
FT                   /translation="MRLAAAFIALLCLLPASAGAQWLPGQATEAVREGLEIGTSTSEIA
FT                   ITSDFHGADLTIFGALSNTDQLLLAVGQYDVVVVLEGPREDATVRKKERVFGIWVNTRS
FT                   MTFEAVPHSYSMSSSRMIDDIVTPLDLTDQGIGIDHIPLTPVGFVGDGSNLGEFREAFR
FT                   RLQQGGGLYDRNPSGVRFVSSNLFKASLRLPANIPNGVHSVRAYLFKSGLFVTEKSLPL
FT                   RVIKTGIEQTITDAAHDQPILYGFAAVLLAVITGWGASLIFRKD"
     atgcgcctgg ctgccgcttt catcgcgttg ctttgcctgc tgccggcctc tgccggagcg        60
     cagtggctgc cggggcaggc aacggaagcg gtgcgtgaag ggctggagat cggcacgtcg       120
     accagcgaaa tcgccatcac ctcggatttc cacggcgcgg atctgaccat cttcggagcg       180
     ctctcgaaca ccgaccaact gctgctcgct gtcggccaat atgacgtggt cgtagtgctg       240
     gaaggcccgc gcgaggatgc gacggtgcgc aagaaggaac gcgtcttcgg catctgggtg       300
     aacacccgct cgatgacctt cgaagcggtg ccgcactcct attcgatgtc gagttcgcgc       360
     atgatcgacg acatcgtgac gccgcttgac ctgaccgatc aggggatcgg catcgaccac       420
     attccgctga cgccggtcgg cttcgtcggc gacggcagca atctcggcga gttccgcgag       480
     gccttccggc ggctgcagca gggcggcggg ctctatgacc gcaacccgag cggcgtacgg       540
     ttcgtttcct ccaacctctt caaggccagc ctgcgcctgc cggcaaacat tccgaacggg       600
     gtgcacagcg tgcgcgccta tctgttcaag agcggccttt tcgtgaccga gaaatcgctg       660
     ccgctgcggg tcatcaagac cggcatcgag cagacgatca ccgatgcggc gcatgatcag       720
     ccgatcctct acggctttgc ggccgtgctg ctcgccgtga tcaccggctg gggtgccagc       780
     ctgatcttcc gcaaggactg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page