(data stored in ACNUC7421 zone)

EMBL: CP001622.PE236

CP001622.PE236       Location/Qualifiers
FT   CDS_pept        complement(245071..245994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0237"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ret:RHE_CH00554 putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54548"
FT                   /db_xref="GOA:C6B0C9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C9"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACS54548.1"
FT                   /translation="MTIYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGSLDVKLGTVLLVGGLTGATVGIWIFSLL
FT                   RAIGQLDLIISLMYVVFLGTVGGLMLLESINAMRRAARNEPPAPRKPGHQHWVHKLPLK
FT                   VRFKKSKIYLSVIPIVALGFAIGILTSIMGVGGGFIMVPAMIYLLRIPTNVVVGTSLFQ
FT                   IIFVTAYTTIVQAATNFSVDIVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVL
FT                   AVGVRLAIALVVTPADVYSVVMGAGN"
     gtgacaatct atctgcccat cgcagaattg tcggtgaaca ttttcatcat tctcggcatg        60
     ggggcggccg tcggattcct gtctggaatg ttcggcgtcg gcggcggctt tctcatcacc       120
     ccgctgttga tcttctacaa catcccgccc gtcgtcgcgg tcgcgaccgg cgccaaccag       180
     gttgtggcgt cgtcgatatc gggcgcgatc acgcatttcc ggcgcggctc gctcgacgtc       240
     aagctcggca cggtgctgct ggtcggcggt cttaccggtg cgacggtcgg catctggatc       300
     ttctcgctgc tgcgcgccat cggccagctc gatctgatca tctcgctgat gtatgtcgtc       360
     ttcctcggca ccgtcggcgg actgatgctg ctcgaaagca tcaatgccat gcggcgggca       420
     gcgcgcaacg agccgcccgc accgcgcaag cccggccacc agcactgggt gcacaagctg       480
     ccgctgaagg tgcgcttcaa gaaatcgaag atctatctca gcgtcattcc gatcgtcgca       540
     ctcggctttg caatcggcat cctcacctcg atcatgggtg tcggcggcgg cttcatcatg       600
     gtgccggcga tgatctacct gctgcgtatc ccgaccaacg tcgtcgtcgg cacctcgctg       660
     ttccagatca ttttcgtgac cgcctatacg acgatcgtac aggcagcgac gaacttttcc       720
     gtcgacatcg tgcttgcctt catcctgatg gtggcgggtg tcattggggc gcaatacggc       780
     gtgcgggtcg gccagaagct gcgcggcgag cagctgcgcg ccctgctcgg cctgctggtg       840
     cttgccgtcg gcgtgcgtct tgcgatcgcc ctggtggtga cgccggccga cgtctattcg       900
     gtggtgatgg gagcgggcaa ttga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page