(data stored in ACNUC7421 zone)

EMBL: CP001622.PE237

CP001622.PE237       Location/Qualifiers
FT   CDS_pept        complement(246309..250100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0238"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; Sel1
FT                   domain protein repeat-containing protein; SMART: Sel1
FT                   domain protein repeat-containing protein; KEGG:
FT                   rec:RHECIAT_CH0000627 putative hemaglutinin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54549"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D0"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACS54549.1"
FT                   /translation="MNGSRSNPSRQSDRTSLDALNRTIEGLEARIEGLMGSGREQRPRT
FT                   AAAERDPYAASHAPRPAKAPPEPRPDPLAEIRQRQRALEASRERPYAREQAPQLREPAP
FT                   RAAAPVPAPALRAGNDTMTEIAQALVNLRQDLKRDISEGVTREMNALRAELREIKTNAG
FT                   DGRFADDMRADMGRLAQSITQLTGRSVAPEATGLREDFEELRSLMDGLAREDSLRHMEN
FT                   RWDGFENRLAALDTEGLQEELVSLAYRLDDIKRHIGGMGESPAVRALEDKLISIATAME
FT                   HFGNMIQPHDRVMSEQFAAMDMRLDEISRAIAASGRTATTNDPGLMQRLENRLEALADQ
FT                   IDLMSHDAASRVNPADELAMRLEALTGRVEEMTKAEATSRLDERLEHLSYLLERTQETA
FT                   PQADLTGTLSDISRKIDALENGAVNDVLAQRLDHLARRIDEMAHQQQAPAPAAVADDSA
FT                   FLRLEGRLSDIAARLEESTSAAPTDPRALKNLEDQIANLSALMSAPRESAVIPPEFDQR
FT                   MGAIEDYMATSDEYIIEAARQAAEAVVEAYSRHGGPQGVMPAADMSALTALAEDLRHLE
FT                   DLSRDSEERTHKTFQALHETLVHIADRLDGMEDRGRPLAQMPVADVDFDVDPYALMVAE
FT                   AELNRTPATAQTAKASPVIRTAEVAAEPAAPAQATAMSGTSAIAIEAATRTTEVATAAR
FT                   AQAPAKASLLASLGKRLLPGKKAESRATERPMIDPAPSIDPTDVVPTDAANELLEPGSG
FT                   APDVKKILERVRASQSAARGKPAGETDRADYIAAARRAAQAAAMEVDANPKQAAVKAEK
FT                   KGANADKAGKTSDKTGKTSAFSRYRRPILLAVGAVLLAIMAFPLARTLTSGERAPQPPA
FT                   EVSALTGAAENPAPPLPEATPAQPDAAALGTTAPAAEAVPPAAEQAQPEATPPDAGEHL
FT                   TDVAPLDGEGAATLAPPGPSGAAQETSGFVPNAPAAAAPAPAITIPDTVQPKSLADAAS
FT                   SGDTLALFEIGARYSDGRNGMTVDQKQAASWYQLAADKGFAPAQYRLGSMYEKGNGVER
FT                   DITKAKGFYEQAANQGNASAMHNLAVLYASGALGQQDYATAAAWFTKAANLGITDSQFN
FT                   LAILCARGNGVPADLEESYKWFAIAAKGGDKDAAQKRDEVAKAMKPDQLERARAKADLW
FT                   KPEPVDHRTNAIDIPDEWAGTGAKTASVDMKKAVRNIQAILNNNGFDAGVPDGEMGAKT
FT                   VTAIKNFQKSVGQEPDGKVTDATVKALLERNKQAGKAI"
     atgaacggat cgcgatcaaa tccttcccga cagtccgaca ggacctcgct cgatgcgctg        60
     aaccgcacga tcgaagggct ggaggcgcgc atcgaagggc tgatgggcag cgggcgcgaa       120
     cagcggccac gcacggcagc ggccgagcgc gatccttatg ccgcttccca tgctccccgg       180
     cccgcaaagg ccccgcccga gccgcggccg gatccgctcg ccgaaatccg tcaacgccag       240
     cgcgcgcttg aagctagccg cgagcggcct tatgcacgcg aacaggcccc gcagcttcgt       300
     gaacctgcgc ctcgcgccgc tgccccagtg ccggcgccgg ccttgcgcgc cggcaacgac       360
     acgatgacgg agatcgccca ggcgctcgtc aacctgcggc aggacctgaa gcgcgacatt       420
     tccgagggcg tcacccgcga gatgaacgcg ttgcgcgccg agctgcgcga aatcaaaaca       480
     aatgccggag acggccgttt cgccgacgac atgcgcgccg atatgggccg ccttgcccag       540
     agcatcaccc aactgaccgg ccgctccgtc gcaccggagg ccaccggcct tcgcgaggat       600
     ttcgaagagc tgcgctcgct gatggacggg ctggcgcgcg aggattcgct gcgccatatg       660
     gaaaaccgct gggacggttt cgaaaaccgg cttgcggcgc tcgataccga ggggctgcag       720
     gaagagctcg tttcgctcgc ctatcggctc gacgacatca agcgccatat cggcggcatg       780
     ggcgagagcc cggccgttcg ggcgctggaa gacaagctga tctcgatcgc cacggcgatg       840
     gagcatttcg gcaatatgat ccagccgcac gaccgggtga tgtccgaaca gttcgccgcc       900
     atggatatgc ggctcgacga gatcagccgg gcaatcgcgg caagcgggcg cacggccacc       960
     acgaatgatc cgggcctgat gcagcggctg gaaaatcggc tggaggcgct ggccgatcag      1020
     atcgacctga tgagccatga tgcggccagc cgcgtgaacc cggccgacga gctggcgatg      1080
     cggctggagg cgctgacggg acgcgtcgag gagatgacga aggcggaagc gacgtcgcgg      1140
     ctcgacgaac ggctggaaca tctctcctat ctgctggagc gcacgcagga gacggcgccg      1200
     caggccgacc tcaccggcac gctttccgac atttcccgca agatcgacgc gcttgagaac      1260
     ggcgccgtca acgacgtgct ggcgcagcgg ctcgaccatc ttgcccggcg tatcgacgag      1320
     atggcccatc agcagcaggc gccggcgcct gctgctgtag ccgacgacag cgccttcctg      1380
     cgtctcgaag gacggctgag cgacattgcc gcccgcctgg aggaaagcac atcggcagcg      1440
     ccgaccgatc cgcgggcgct gaagaacctc gaagaccaga tcgccaatct gtcggcgctg      1500
     atgagcgcgc cgcgcgagag cgctgtaata ccccccgaat tcgaccagcg catgggcgcg      1560
     atcgaagact atatggcgac gagcgacgaa tatatcatcg aggccgcacg ccaggcggca      1620
     gaggccgtgg tcgaagccta ttcgcgtcat ggcggcccgc agggtgtcat gccggccgcc      1680
     gacatgtcgg cgctgacggc gctggccgag gatctgcgcc acctcgagga tctcagccgc      1740
     gacagcgagg aacgcacgca caagactttc caggcgctgc acgagacgct ggtgcatatc      1800
     gccgatcggc tcgacggcat ggaagatcgc ggccggccgc tcgcccagat gccggtcgcc      1860
     gacgtcgatt tcgatgtcga tccctatgcc ctgatggtgg ccgaagccga gctgaacagg      1920
     acgccggcca ctgcccagac agcgaaggct tctcctgtta ttcgcacggc cgaggtcgcc      1980
     gccgaacctg ccgccccggc gcaagccacc gccatgagcg gaacgagcgc gatcgccatc      2040
     gaagccgcga ccaggacgac ggaagttgcg acagccgcac gggcacaggc cccggcgaag      2100
     gccagcctgc tcgccagcct cggcaagcgg ctgctgcccg gcaagaaagc cgagagcagg      2160
     gcgaccgagc gtccgatgat cgaccccgcg ccgtcgatcg atcccaccga cgtggtgccg      2220
     acggatgcgg caaacgaact gctcgagccg ggctcgggcg cgcctgacgt gaagaagatc      2280
     cttgaacggg ttcgcgccag ccagagtgcg gcacgcggca agcctgccgg cgaaaccgat      2340
     cgcgccgatt acatcgctgc tgcgcgccgt gcggcacagg cggctgcgat ggaggtggat      2400
     gccaatccga agcaggcagc cgttaaggcc gagaaaaagg gcgcgaacgc cgacaaggcc      2460
     ggcaagactt ccgacaagac gggcaagacc agcgcctttt cgcgctaccg gcggccgatc      2520
     ctgctggccg tcggcgccgt gctgctcgcc atcatggcct ttccgctcgc ccgaacgctg      2580
     acgagcggcg agcgcgcgcc gcagccgcca gccgaagtct cggcgctgac gggtgctgcg      2640
     gaaaacccgg cgccgccctt gcctgaagcg acacctgccc agccggatgc cgccgctctc      2700
     ggaacgaccg ctccggcagc ggaagctgta ccgcccgccg ccgaacaggc tcagccggaa      2760
     gcaaccccac ctgacgccgg cgagcatctg accgacgtgg cgccgcttga cggcgaaggg      2820
     gctgcgaccc ttgcccctcc cggtccgtcg ggcgcggcac aggagacatc gggcttcgtt      2880
     ccgaacgccc cggctgcggc ggcacccgca ccggccatca ccattcccga caccgtccag      2940
     ccgaaatcgc ttgccgatgc ggcgagcagc ggcgatacgc tggcgctgtt cgagatcggc      3000
     gcgcgttatt cggacggccg caacggcatg acggtcgatc agaagcaggc ggcgagctgg      3060
     taccagcttg cggcggataa gggctttgcg cccgcgcaat accggctcgg cagcatgtac      3120
     gagaagggca acggcgtcga acgcgacatc accaaggcga agggcttcta cgaacaggcg      3180
     gccaaccagg gcaatgccag cgccatgcac aatctcgccg tgctctacgc ctccggcgcg      3240
     cttggccagc aggattatgc gacggccgcc gcgtggttca ccaaggcagc gaacctcggc      3300
     atcaccgaca gccagttcaa cctggccatc ctctgcgccc gcggcaacgg ggtcccggcg      3360
     gatctcgaag agtcctacaa gtggtttgcg atcgccgcca agggcggcga caaggatgcg      3420
     gcgcagaagc gcgacgaagt ggccaaagcc atgaaacccg accagctcga acgggcgcgc      3480
     gccaaggccg atctctggaa accggagccg gtcgaccacc gcacgaacgc catcgacatc      3540
     cccgacgaat gggccggcac cggcgcgaag acggcgagcg tcgacatgaa gaaggcggtc      3600
     cgcaacatcc aggcgatcct caacaataac ggcttcgacg ccggcgtgcc ggacggcgaa      3660
     atgggcgcga agaccgtgac cgcgatcaag aacttccaga agtcggtcgg ccaggagccg      3720
     gacggcaagg tgaccgatgc gaccgtgaag gcgctgctcg aacgcaacaa gcaggccggc      3780
     aaagcgatct ga                                                          3792
//

If you have problems or comments...

PBIL Back to PBIL home page