(data stored in ACNUC7421 zone)

EMBL: CP001622.PE238

CP001622.PE238       Location/Qualifiers
FT   CDS_pept        complement(250427..250792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0239"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000628 putative
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54550"
FT                   /db_xref="GOA:C6B0D1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54550.1"
FT                   /translation="MPRLDHVTIETRDAPVMIGFLETLLGVREGYRPPFASPGHWLYLD
FT                   ECPVIHLSLTSRSTDFPPGIFNHVAFSLYEFEPALERIKATGYRYEYYDIPDTDLGQVF
FT                   VYGPEGVKIELQYPRPA"
     atgccgcgcc tggaccacgt caccatcgaa acccgtgatg cccccgtcat gatcggtttt        60
     ctggaaacct tgctcggcgt cagggaaggc tatcggccac ccttcgcctc gcccggccat       120
     tggctctatc tcgacgagtg cccggtcatt catctcagcc tgacatcacg cagcaccgat       180
     tttccgcccg gcatcttcaa ccacgtcgcc ttcagccttt acgaattcga gccggcgctg       240
     gaacgcatca aggcgaccgg ctatcgctac gaatattacg atattcccga caccgatctc       300
     ggccaggtct tcgtctatgg ccccgaaggc gtgaaaatcg agctgcaata tcccaggccc       360
     gcctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page