(data stored in ACNUC7421 zone)

EMBL: CP001622.PE239

CP001622.PE239       Location/Qualifiers
FT   CDS_pept        complement(250879..251580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0240"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:blr7900 putative nodulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54551"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54551.1"
FT                   /translation="MTDFPYESALIVGAGSGISASLARQLSAQGVKVGLAARNIEKLQG
FT                   LIEETGASAFTTDVSQPASVAALFEEAAAAIGGPDVVIFNASARQRGPLAELDPADVEK
FT                   AIATSAFGGFLVVQQAARRMIPRGRGAILITGASASVKGFAQSAPFAMGKFALRGLAQS
FT                   AARELGPMGIHVAHFVIDGAVRSQIRPDRVEKPDGTLLPEAIAQTYIDVLRQHRSAWSL
FT                   EVEVRPWTESF"
     atgaccgact ttccctatga gagtgcgctg atcgtcggcg cgggctccgg catcagcgca        60
     tcgcttgccc ggcaattgtc ggcgcagggc gtcaaggtcg ggctcgccgc ccgcaatatc       120
     gagaaactgc aagggctcat cgaagagacc ggcgccagcg cctttacaac agatgtctcg       180
     caacctgcga gcgtcgcagc actcttcgaa gaggctgccg ccgcaatcgg cgggcctgac       240
     gtggtgatct tcaatgccag cgctcgtcag cgcggcccgc tcgcagaact cgatcccgcc       300
     gatgtcgaga aggcgattgc gacctccgct ttcggcggtt tcctggtggt gcagcaggca       360
     gcgcggcgga tgatcccgcg cggccgcggc gccattctga tcaccggcgc gtcggcaagc       420
     gtgaagggct ttgcgcaatc agcccccttc gcgatgggca agttcgcgtt gcgcggcctt       480
     gcccagagtg cagcccgcga actcgggccg atgggcatcc atgtcgcgca tttcgtcatc       540
     gacggcgcgg tgcgctcgca gatccggccg gaccgggtgg agaagccgga tggcacgctg       600
     ctgccggagg ccatcgccca gacctatatc gacgtgcttc gccagcaccg cagcgcatgg       660
     tcgctggagg tggaagtccg gccctggacg gagagcttct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page