(data stored in ACNUC7421 zone)

EMBL: CP001622.PE24

CP001622.PE24        Location/Qualifiers
FT   CDS_pept        22950..24371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0024"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   eca:ECA2654 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54336"
FT                   /db_xref="GOA:C6AYB2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS54336.1"
FT                   /translation="MTVAKSNDFPPLDPNAGVPFYRQIYDRFRAAIASGLLKPGDRIPS
FT                   ARALTKELGLARGTIESAYSLLAAEGYIESHGQAGTVVTPGLSTLTPVPVPALQQISNA
FT                   AEVSFRPDSILPFQMGLPALDAFPRKIWARLGAGCVRAMQPSDMVHPPIYGLPALRTEI
FT                   ATYLQVSRGIGCSPSQVFITSGYRHTIELIADTLLKAGDHVWLEDPGYPPTREIFRHMQ
FT                   ITTVPVRVDQDGMVISDGLKAAHGAVAAVVTPAHQSPLGMSLILPRRLALLDWAAKSKS
FT                   WIIEDDYDGEYRYVSRPLPALKSLDRNGRVLYSGTFSKVLFPGLRLAYLVVPEDLVERF
FT                   EHISQTLAGGSPELTQAIVTAFIKEGHFARHIQRMRKLYAQRRKATAIGLETVLGKHMS
FT                   IASQPGGMHLILQLKNQHSDRLLSARMRESGLYAEALADWTMLSEAPAALLVNFTNIGS
FT                   QSVAEHLAKRILQLM"
     atgaccgtcg cgaagagcaa cgacttcccg ccactagatc cgaacgcagg cgtgcctttc        60
     tatcggcaaa tctacgatcg gttccgcgcc gccattgcct cgggcctttt gaagcccggg       120
     gaccggatac cctcggcgcg ggcgctgaca aaagaactcg gtttggcaag aggtacgatc       180
     gaatcggcat attctttgct cgcagccgag ggatacatcg aatcacacgg tcaagcaggt       240
     accgttgtaa caccgggcct cagtacgctc acgcctgtgc ctgtcccagc cctgcagcaa       300
     ataagcaatg cagcggaggt tagctttcgt ccggattcca ttttgccgtt tcagatgggc       360
     ttgccagccc tcgatgcatt tcctcggaag atctgggcgc ggctgggcgc gggatgcgtc       420
     cgcgctatgc agccgtctga tatggtccat cctccaatat acggcctacc cgcactgcga       480
     acggagatcg caacttacct gcaggtttcg cgaggaattg gctgctcacc ttctcaggta       540
     ttcataacat caggttatcg ccacaccata gaactgatcg ccgacacttt gttgaaggca       600
     ggagaccacg tctggcttga ggatccgggg tatccgccaa cgcgagagat attcagacac       660
     atgcaaatca cgaccgtccc agtgcgagtg gatcaagacg ggatggtgat atccgatggc       720
     ttgaaggcgg cccatggcgc tgttgcagcc gttgtgacgc ccgcacacca aagtccactg       780
     ggcatgtctt tgattttgcc gcggcgatta gcgctcctgg actgggccgc gaaaagtaag       840
     tcttggatta tcgaggacga ctatgacggc gagtaccgct acgttagtcg tccgctgccc       900
     gcgctaaaga gcttggatcg caatgggcgt gtcctctatt ccggcacctt cagcaaggtt       960
     ctctttccgg gtcttcgact agcttatctt gtcgtcccgg aagacctggt cgagcggttt      1020
     gagcatatca gccaaacttt agcgggaggg agtcctgagc ttacacaagc catcgtcacc      1080
     gcgttcatca aagaggggca cttcgcgcgt catatccaac ggatgcgaaa actttatgct      1140
     cagcgcagga aagcaacggc gataggcctc gagacggtcc ttggaaagca catgagcatt      1200
     gcctcccaac cgggtgggat gcacttgatt ctccagctga aaaaccagca ctcagaccgc      1260
     ttgctttcag cgcgtatgcg ggaaagcgga ctttacgcgg aggccttggc cgattggacg      1320
     atgctttcgg aagcgccggc ggccctgctc gtcaacttca cgaacattgg cagccaaagc      1380
     gtggcggagc acctcgcaaa gcggatattg caactcatgt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page