(data stored in ACNUC7421 zone)

EMBL: CP001622.PE240

CP001622.PE240       Location/Qualifiers
FT   CDS_pept        251851..253647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0241"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000630 acyl-CoA dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54552"
FT                   /db_xref="GOA:C6B0D3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D3"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS54552.1"
FT                   /translation="MPVYKAPVNDTLFVLNDVLGLERYNNLPGFADATPDMIEAILGEA
FT                   GRVAEEALFPLNYSGDQEGCTRHDDASVSTPKGFKEAYKAYREGGWIGLAVPEEFGGQG
FT                   LPYTLHTAVGEYTSAANMSLMMYPGLTQGAIAALLVHGSDEQKATYLPKMVDGTWSGTM
FT                   NLTEPHCGTDLGMLRTKAVPQADGSYKISGQKIFISAGEHDLTGNIIHLVLARIEGAPE
FT                   GTKGISLFIVPKFLVGKDGAPGARNAVSCGAIEHKMGIHANATCVMNYDEATGFLIGAE
FT                   NRGLNAMFVMMNEARLMVGLQGIAISEIAYQNAASYARDRIQGRSLSGPKAPDKKADPI
FT                   IVHPDIRRTLMTIRAFNEAGRAFLLWTALKSDIAHRASDEKERQTADDILGLVTPILKG
FT                   VMTDKGFDHAVMAQQVFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAL
FT                   NGGRAAMALFKEIGDFCEENRGNEKLSFFTKHLKKGLNDAQGATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVILGYMWAKMAKAAEDGLASGDAAREEYLKNKLVTARFFMERLMPET
FT                   ALRKARIEAGADTMMELAAEAF"
     atgccagtct acaaggcccc ggtgaacgat acgctcttcg tcttgaacga cgtgctgggt        60
     ctcgaacgct acaacaatct gccgggtttt gccgatgcga cccccgatat gatcgaagca       120
     atcctcggtg aggccggaag ggttgccgag gaagctctct ttccgttgaa ctattccggc       180
     gatcaggaag gctgcacgcg ccacgacgat gccagcgtct cgacgccgaa gggcttcaaa       240
     gaggcttata aagcctatcg cgaaggcggc tggatcggcc ttgcggtgcc ggaggaattc       300
     ggcgggcagg ggcttcccta tacgctgcat accgccgtcg gcgaatatac ctccgccgcc       360
     aacatgtcgc tgatgatgta tccaggcctg acacagggcg cgatcgccgc actcctcgtc       420
     cacggctccg acgagcagaa ggccacctat ctgccgaaga tggtggacgg cacgtggtcc       480
     ggcaccatga acctcaccga gccgcattgc ggcaccgatc tcggcatgct gcgcaccaag       540
     gcggtgccgc aggctgacgg cagttacaag atctccggcc agaagatctt catctccgcc       600
     ggcgagcacg acctgaccgg caatatcatt catctggtgc tggcccgcat cgagggtgcg       660
     cccgagggca ccaagggcat ttcgctcttc atcgttccga aatttctcgt cggcaaggac       720
     ggcgcaccgg gcgcccgcaa cgctgtctcc tgcggcgcca tcgagcacaa gatgggcatc       780
     cacgccaacg ccacctgcgt gatgaattac gacgaggcga ccggcttcct gatcggcgcc       840
     gaaaaccgcg gcctcaacgc catgttcgtg atgatgaacg aggcccgcct gatggtcggc       900
     ctgcagggca tcgccatttc cgagatcgcc tatcagaacg ccgccagcta cgcccgcgac       960
     cgcatccagg gccgctcgct gtccggcccc aaggcgcccg acaagaaggc cgatccaatc      1020
     atcgtccatc cggacattcg ccgcacactg atgaccatcc gcgccttcaa cgaggccggc      1080
     cgcgccttcc tgctctggac cgcgctgaag tccgatatcg ctcaccgcgc cagcgacgag      1140
     aaggagcgcc agacggccga cgatattctc ggcctcgtca ccccgatcct taagggcgtg      1200
     atgaccgaca agggcttcga tcatgccgtc atggcccagc aggtcttcgg cggccacggc      1260
     tatatcgaag agcacggcat gagccagtat gtgcgcgatg cccgcatcgc catgatctat      1320
     gagggcgcca acggcattca ggcgctcgat cttgtcggcc gcaagctggc gctgaacggc      1380
     ggccgcgccg cgatggccct cttcaaggag atcggcgatt tctgcgagga gaaccgcggc      1440
     aacgaaaagc tctccttctt caccaagcat ctgaagaagg gcttgaacga tgcccagggc      1500
     gcgaccatgt ggttcatgca gaatgccatg gccaaacccg acaatgccgg cgccggctcg      1560
     accgactaca tgcacctctt cggcctcgtc attctcggct atatgtgggc gaagatggcc      1620
     aaggccgccg aggacggcct tgcatccggc gatgccgccc gcgaggagta cctgaagaac      1680
     aagctggtca ccgcccgctt cttcatggaa cgcctgatgc cggaaaccgc gcttcgcaag      1740
     gcccgcatcg aagccggcgc cgacacgatg atggaactgg ccgccgaagc gttttga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page