(data stored in ACNUC7421 zone)

EMBL: CP001622.PE241

CP001622.PE241       Location/Qualifiers
FT   CDS_pept        253787..254995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0242"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: ret:RHE_CH00558 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54553"
FT                   /db_xref="GOA:C6B0D4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D4"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS54553.1"
FT                   /translation="MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGL
FT                   DTATVDDIIMGCVDPVMDAGAVIPKAAAFEAGYSTKAPGMQISRFCASGLDAVNFGAGK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSR
FT                   TDVDAYAVESQKRAAHAWEKGWFDKSVIPVKDQNGLTILAKDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVGIQAHPEIERINYVHHAGNSSGIVDGASVVLLGSKAGGQSMGKKP
FT                   RARIKAFANIGSDPALMLTGPVDVTEKLLKRSGMSLSDIDLFELNEAFAAVVLRYMQAF
FT                   DIDHDRINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVI
FT                   ERV"
     atgaccgagg ttttcattta cgaccacgtg cgtacgccgc gcggccgcgg caagaaggac        60
     ggcgccctgc atgaggtgcc ctccgttcgc ctcgcggcaa agacgctgga agcgatccgc       120
     gaccgcaacg ggctcgacac ggccacggtc gacgacatca tcatgggctg cgtcgatccg       180
     gtcatggatg ccggcgccgt catccccaag gccgccgcct tcgaagccgg ttactccacc       240
     aaggcacccg gcatgcagat ctcccgcttc tgcgcctccg gcctcgatgc cgtcaatttc       300
     ggcgccggca agatcgccca aggcgccgac gatattgtca ttgccggcgg cgtcgaaagc       360
     atgtcccgcg tcggcctcgg catgtccggc ggcgcctggt tcatggaccc ttctgtgaat       420
     tttccggcct atttcatgcc gcaaggtgtc tcggccgatc tgatcgccac caaatacggc       480
     ttcagcagaa ccgatgtcga cgcttatgcg gtcgagagcc agaagcgtgc cgcccatgcc       540
     tgggaaaagg gctggttcga caagtcggtc atcccggtca aggaccagaa cggcctgacg       600
     atcctggcaa aggatgagca tatgcgtccc ggcaccgata tgcaggcgct cgcctccctc       660
     aatccgtcct tccagatgcc cggcgagatg ggcggcttcg aggccgtcgg catccaggcc       720
     catccggaga tcgagcgcat caactatgtc caccatgccg gcaattcctc cggcatcgtc       780
     gatggcgcca gtgtcgtcct gctcggctcc aaagccggcg gtcagagcat gggcaagaag       840
     ccgcgcgccc gcatcaaggc tttcgccaac atcggctccg atccggccct gatgctgacc       900
     gggcccgtcg acgtcacaga gaagctgttg aaacgatcag gcatgagcct ttccgacatc       960
     gacctcttcg aactgaacga ggccttcgct gccgtggtgc tgcgctacat gcaggcattc      1020
     gacatcgacc atgacaggat caacgtcaat ggcggcgcca tcgccatggg ccatccgctc      1080
     ggcgccaccg gcgcgatgat cctcggcacg gtgctggacg agcttgaacg ccgcgacctc      1140
     aacaccgcgt tggtgaccct ctgcatcggc gccggcatgg gcacggcaac ggttatcgag      1200
     agggtctga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page