(data stored in ACNUC7421 zone)

EMBL: CP001622.PE242

CP001622.PE242       Location/Qualifiers
FT   CDS_pept        254998..255381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0243"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bac:BamMC406_6039 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54554"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACS54554.1"
FT                   /translation="MGFNTGTIETEYAEVSEHWSPRVIADLNGQSVKLAKVRGQLAWHS
FT                   HRDEDELFLIWKGALTIEYRDRPHVHLKSGDFHVVPRGVEHNPVAEEECWIVLFEPSLT
FT                   KHTGDVVTEKTKTLDAQRSHLPA"
     atgggcttca acaccggcac gatcgaaacc gaatatgccg aggtcagcga gcactggtcg        60
     ccccgcgtca tcgccgatct caacggccag agcgtcaagc tcgccaaggt taggggccag       120
     ctcgcctggc attcccaccg cgacgaagac gagcttttcc tcatctggaa gggagcgctg       180
     accatcgaat atcgcgaccg cccgcatgtg catctcaaga gtggcgattt tcatgtcgtg       240
     ccaaggggtg tcgagcataa tcctgttgct gaggaggaat gctggatcgt gcttttcgag       300
     ccgtcgctga ccaagcacac cggcgatgtc gtcaccgaaa agacgaagac cttagacgcg       360
     cagcgcagcc atttgccggc ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page