(data stored in ACNUC7421 zone)

EMBL: CP001622.PE243

CP001622.PE243       Location/Qualifiers
FT   CDS_pept        255398..257611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0244"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain protein; KEGG: ret:RHE_CH00559
FT                   enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54555"
FT                   /db_xref="GOA:C6B0D6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D6"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACS54555.1"
FT                   /translation="MTYTNFTLETDADGIALVTWDMPGKSMNVFTAEVMAELDAIIDAT
FT                   TADAAVKGVVFTSGKSSFSGGADLSMIKSMFSSYQEEKAKSPETAVQNLFGLVGRMSGL
FT                   FRKLEISGKPWVSAINGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGT
FT                   QRVPRLANAQDALQMMTTGQSLTGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAP
FT                   WDEKGFKAPGGGIWTPASAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGL
FT                   KIEQRYFTEVLQTREAFSMIRSLFISMQELGKGARRPAGHAKTELKHVGVVGAGFMGAS
FT                   IAYVTAAAGIPVTLIDRDIEAATKGKTVSEGLVKDSIGKGRLTQDEAAALLSRITPSAD
FT                   YADLANADLVIEAVFEDREVKKAVIEAVEAVLPEGAIFASNTSTLPISGLAKNSKRPAD
FT                   FIGIHFFSPVEKMMLTEVILGSDTGDKALAVALDYVAAIRKTPIVVNDTRGFFVNRCVL
FT                   RYMSESYDMLIEGVPPVMIENAAKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKA
FT                   IDPRHMDLISSMVEKEGRFGRKNSKGFYDYPPKPAKKSLWPDLKSFYPQKQADEVDVNV
FT                   LKQRFLVTIALEAARTVEEGIVTDPREADVGSILGFGFAPYTGGALSYIDGMGAKAFVE
FT                   LAEKLAGTYGKHFKPTPLLKDMAAKGETFYGRFDPYAKVGKAA"
     atgacctaca ccaatttcac gctcgaaacc gacgccgatg gcatcgctct cgtcacctgg        60
     gacatgcctg gcaaatcgat gaacgtcttc accgccgagg tgatggccga actcgacgcc       120
     atcatcgacg ctacgaccgc cgatgccgcc gtcaagggtg tcgtcttcac ttcgggcaag       180
     tcctccttct ccggcggcgc cgatctgtcg atgatcaagt cgatgttcag ttcttatcag       240
     gaggagaagg caaagagccc cgagacggcg gtgcagaacc tcttcggtct ggtcggccgc       300
     atgagtggcc tgttccgcaa gctcgaaata tcgggcaagc cctgggtgtc cgccatcaac       360
     ggcacctgca tgggcggcgc tttcgaactg tcgctcgcct gccacggccg cgtcgcctcc       420
     aatgccaaga gcgtcaagat cgcgctgccc gaagtgaagg tcggtatctt ccccggcgcc       480
     ggcggcacgc agcgtgtgcc gcggctggcg aacgcccagg atgcgctgca gatgatgacg       540
     accggccagt cgctgaccgg ctcccgcgcc aaggcgatga acctcgtgca ccaggtggtc       600
     gagccggatc agctcatccc cgccgccaag cagatgatca aggatggcct gaagccggtc       660
     gccccctggg acgagaaggg cttcaaggcg cccggcggcg gcatctggac gccggcttcc       720
     gcccagctct ggccggcagc tccggcaatc ctgcgccggg aaacatcggg caattatccg       780
     gcggcactcg ccattttgaa atgcgtctat gaaggtctgc aggtgccttt cgacaccggc       840
     ctgaagatcg agcagcgtta tttcaccgag gtgctgcaga cccgcgaagc cttctcgatg       900
     atccgttcgc tgttcatctc catgcaggag ctcggaaaag gcgcccgccg cccggcgggt       960
     catgcgaaga ccgagctgaa acatgtcggc gtcgtcggcg ccggcttcat gggcgcctcg      1020
     atcgcttatg tcaccgccgc cgccggcatt ccggtgacgt tgatcgaccg cgacatcgaa      1080
     gcggcgacca agggcaagac cgtctccgaa ggcctggtca aggattctat cggtaagggg      1140
     cgtcttacgc aagatgaggc agccgcattg ctctcccgca tcaccccctc ggcagattat      1200
     gccgacctcg ccaatgccga tctcgtcatc gaggcggtgt tcgaggatcg cgaggtgaag      1260
     aaagcggtca tcgaggcggt cgaagccgtg ctgccggaag gcgcgatctt cgcctccaat      1320
     acctcgaccc tgccgatctc aggtctcgcc aagaattcga aacgcccggc cgatttcatc      1380
     ggcatccact tcttctcccc tgtcgagaag atgatgctga ccgaggtcat cctcggaagc      1440
     gacaccggcg acaaagcgct ggccgtcgct ctcgattatg ttgcagccat caggaagacg      1500
     ccgatcgtcg tcaacgacac ccgcggcttc ttcgtcaatc gctgcgtgct gcgttacatg      1560
     tcggaaagct acgatatgct gatcgagggc gtgccgcctg tcatgatcga gaacgccgcc      1620
     aagatggccg gcatgccggt cggtcccttg gcgctgaacg acgaggtcgc catcgacctc      1680
     tcgctgaaga tcctcaaggc gacggtcgcc gatctcggcg aaaaagccat cgaccccagg      1740
     catatggatc tcatctccag tatggtggaa aaggagggtc gtttcggccg caagaattcc      1800
     aagggcttct acgactaccc gccgaaaccg gcgaagaagt ccctctggcc cgacctcaag      1860
     tccttctatc cgcagaagca ggcagatgag gttgatgtca acgtcctcaa acagcgtttc      1920
     ctcgtcacca tcgcgctgga agctgcccgc acagtcgagg aaggcatcgt caccgatccg      1980
     cgcgaggcgg atgtcggctc gatcctgggc tttggcttcg cgccctatac cggcggggcg      2040
     ctgagctata tcgacgggat gggtgcgaag gctttcgtgg aattggcgga aaagttagca      2100
     ggtacttacg gaaaacactt caagccgacg ccgctgctga aggacatggc cgccaagggc      2160
     gagacgtttt acggtcggtt cgacccctat gcgaaggtgg ggaaggcggc ttag            2214
//

If you have problems or comments...

PBIL Back to PBIL home page