(data stored in ACNUC7421 zone)

EMBL: CP001622.PE244

CP001622.PE244       Location/Qualifiers
FT   CDS_pept        257728..258291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54556"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D7"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3660"
FT                   /protein_id="ACS54556.1"
FT                   /translation="MQPSTDILAFADPMEWESWLCLHHAASTGAWLKIGKKNPKRTLIT
FT                   IDEALDVALCYGWIDSQRKGFDAHSYLQRYSPRRAKSSWSKLNVDRVAALAETGRMRPA
FT                   GLAEVAAAKADGRWAVAYAPQRDAGLPDDLAAALAENAAADAAFARLDKTGQYAIVLPL
FT                   LKATTPEVRVARLGKAITRLAQAE"
     atgcaaccgt caaccgacat cctcgccttc gccgatccga tggagtggga atcctggctc        60
     tgcctgcatc acgcggcatc gaccggcgcc tggctgaaga tcggtaagaa aaatccgaaa       120
     cgaactctca tcaccatcga cgaggcgctg gatgtggcgc tctgttacgg ctggattgac       180
     agccagcgca aggggtttga cgcgcattcc tacctgcagc gttattcgcc ccgccgcgcc       240
     aaaagttcgt ggtcgaagct caatgtcgat cgggtcgcag cactcgcaga aaccgggcgc       300
     atgcggcccg cgggccttgc cgaagtcgct gccgccaaag ccgacggacg ctgggctgtc       360
     gcctacgctc cgcagcgcga tgccggcctg ccggacgatc tggcggcggc gctcgctgag       420
     aacgctgccg ccgatgctgc ctttgcgcgg ctcgacaaga ccggccaata tgcaatcgtc       480
     ctgccgctcc tgaaggctac caccccggaa gtccgggttg cccgcctcgg caaggcgatc       540
     accaggttgg cgcaggccga atag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page